(data stored in ACNUC7421 zone)

EMBL: CP001600.PE452

CP001600.PE452       Location/Qualifiers
FT   CDS_pept        487747..487890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67723"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH40"
FT                   /protein_id="ACR67723.1"
FT                   /translation="MCIHLPVIHSTKPREIRLYTRCVDALWITTIYRCLFTLQTLYMGM
FT                   AI"
     gtgtgcatcc atctaccggt tatccacagc acaaagccgc gtgaaatcag gctttacacg        60
     cgttgtgtgg atgctttgtg gataactact atatataggt gtttgtttac gctacagaca       120
     ctatatatgg gaatggcgat ttga                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page