(data stored in ACNUC7421 zone)

EMBL: CP001600.PE453

CP001600.PE453       Location/Qualifiers
FT   CDS_pept        complement(488137..488424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0489"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67724"
FT                   /db_xref="InterPro:IPR025612"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH41"
FT                   /protein_id="ACR67724.1"
FT                   /translation="MNHQRQTLAAEKARLLQKIAQQRLDLHTESLCAERLCINVDRTLT
FT                   TLWRLRRSLSLAAGLAVVYAARHPSRLPGGIKQAVGLWSTLRLARRMFYP"
     atgaaccacc aacgccagac cctggccgct gaaaaagcgc gacttttgca aaaaattgcg        60
     cagcagcgcc tggatctgca taccgagtcg ctgtgcgccg aacggctgtg catcaatgtg       120
     gatcgcactc tgaccacgct gtggcgtcta cgtcgctctc tgtcgctggc cgctggtctg       180
     gctgtggtct acgctgcccg tcatccctcc cgcctgccgg gcggtataaa acaggccgtt       240
     ggcctatgga gcaccctgcg tttggcacgt cgcatgtttt atccatga                    288
//

If you have problems or comments...

PBIL Back to PBIL home page