(data stored in ACNUC7421 zone)

EMBL: CP001600.PE454

CP001600.PE454       Location/Qualifiers
FT   CDS_pept        complement(488421..488825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0490"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67725"
FT                   /db_xref="GOA:C5BH42"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH42"
FT                   /protein_id="ACR67725.1"
FT                   /translation="MPGDTSPSQGSASGILGTARRIVTLLLGMTETRLRLAVVELEEER
FT                   ANLIQLLLMAGITLLFTAFGLMCLLVLLFLAVEPTYRLMALGIATALLLLLACVGAIWT
FT                   LIKARRSTFLLATRKQLEIDRQLLERREKP"
     atgccaggcg atacctcccc ctcccagggt tccgcctccg ggatcctggg cacagcccga        60
     cgtatcgtca ccctgctgct cggaatgacg gaaactcgtt tacgcctggc agttgtcgaa       120
     ctggaagagg aaagagccaa cctcattcag ttactgctga tggccggcat cacgctcttg       180
     ttcaccgcct ttggtttgat gtgcctgttg gtactgcttt ttttggccgt cgagccaacc       240
     tatcgcctga tggccttggg gatagctacc gctctgctgc tgttgctggc ctgcgtcggc       300
     gcgatctgga cgctgataaa agcgcgccgc tccacctttt tactggccac ccgcaaacag       360
     cttgagatcg atcgccagct gctggaacgc cgggagaaac catga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page