(data stored in ACNUC7421 zone)

EMBL: CP001600.PE455

CP001600.PE455       Location/Qualifiers
FT   CDS_pept        complement(488825..489130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0491"
FT                   /product="Bacterial protein of unknown function (DUF883)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67726"
FT                   /db_xref="GOA:C5BH43"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH43"
FT                   /protein_id="ACR67726.1"
FT                   /translation="MTNDSTAEHLRAELKSLADALEDVLNSSTDKPKAELEKLRARAHD
FT                   ALHNSRERLSQAGESVATQTREMAGRADDYVRDNPWTGVGIGAAVGIVLGVLLARR"
     atgactaacg attccaccgc tgaacatctg cgtgccgagc tgaaatccct ggctgacgcg        60
     ctggaagatg tactcaactc atctaccgat aagcctaagg ccgagctgga aaaactgcgc       120
     gcccgtgccc atgatgcgct gcacaacagc cgtgagcgtc taagccaggc cggcgaaagc       180
     gtggcgacac agacccgaga aatggccgga cgagccgatg actatgtccg ggataatccc       240
     tggaccggcg ttggtatcgg tgccgctgtc ggcatagtgc ttggcgtgct gctggcccgc       300
     cgctga                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page