(data stored in ACNUC7421 zone)

EMBL: CP001600.PE456

CP001600.PE456       Location/Qualifiers
FT   CDS_pept        complement(489403..489819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0492"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67727"
FT                   /db_xref="GOA:C5BH44"
FT                   /db_xref="InterPro:IPR026574"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BH44"
FT                   /protein_id="ACR67727.1"
FT                   /translation="MNQANSQPFTRRQGWKRILGLLLFIVAALTVVILPQLGHKEVSLQ
FT                   IRATHNGLATPDGFFVYQKLDENGVSITSITQDREGLVIRLAHPEQRTLALQVLQRELP
FT                   PGYSIADKILHRSLFYKSERPAAATLSYSAGHNR"
     gtgaaccagg caaactcaca gccatttacc cgcaggcagg gctggaaacg catattaggc        60
     ctgctgctgt tcatcgtcgc cgcccttacg gtggtgatct taccgcagct gggtcataaa       120
     gaggtctctc tacagatccg ggcaacccat aacggcctgg ccacgcccga cggctttttt       180
     gtctatcaaa agctggacga aaacggcgtc agtatcacca gcatcacaca ggatagggag       240
     gggctggtca tacgcttggc gcatcccgaa cagaggacgc tggcgctgca ggtactgcag       300
     cgtgaactac cgcccggtta tagcattgcc gataaaatcc tgcatcgctc gctgttttat       360
     aaaagcgagc gccccgctgc cgccaccctt tcttacagcg ctggccacaa ccgctaa          417
//

If you have problems or comments...

PBIL Back to PBIL home page