(data stored in ACNUC7421 zone)

EMBL: CP001600.PE457

CP001600.PE457       Location/Qualifiers
FT   CDS_pept        complement(489821..490501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0493"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67728"
FT                   /db_xref="GOA:C5BH45"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH45"
FT                   /protein_id="ACR67728.1"
FT                   /translation="MDIIRELITALWHQDYETLANPSLVWTIYGILFMILFLENGLLPA
FT                   AFLPGDSLLILVGVLIARDTMDFPLTLLVLTSAASLGCWVGYLQGRWLGNTHLVQKWLS
FT                   HLPAHYHQRAHQLFHRHGLAALLIGRFLAFVRTLLPLIAGLSGLSAPRFQFFNWVSGLL
FT                   WVLILSTLGYVLGKTPLFLRYEDQLMNLLMLLPLVLLVFGLCGSLLVLWRKKHAHATDK
FT                   SPRK"
     atggatataa ttagagaatt aatcactgcc ctgtggcatc aggactatga gacgctggcg        60
     aatccttcgc tggtctggac gatttacggc attctgttca tgatcctctt tctggaaaat       120
     ggcctgctgc cggcagcctt cttgcccggg gacagtctgc ttattttggt cggggtgctg       180
     atcgcccgcg ataccatgga ttttccgctg acactgctgg tgctaacctc cgccgccagc       240
     ctgggctgct gggtaggcta cctgcaggga cgctggctgg gcaatactca cttagtccag       300
     aaatggcttt cacatctgcc cgcccactac catcagcgcg cccaccagct gttccatcgc       360
     catggcctgg ccgccctgtt aattgggcgc tttctcgcct tcgtccgcac cctcctgccg       420
     ctgattgccg gcctctcagg gctaagcgct cctcgcttcc agtttttcaa ctgggtaagc       480
     ggcctgctgt gggttttaat cctgagcacc ctgggctatg tgctcggcaa aacaccgcta       540
     ttcctgcgct atgaggatca actgatgaac ctgctgatgc tgctgccgct ggtactgctg       600
     gtctttggcc tgtgtggttc tctgctggtg ctatggcgga aaaagcacgc ccatgccacc       660
     gataaaagcc cgaggaaatg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page