(data stored in ACNUC7421 zone)

EMBL: CP001600.PE459

CP001600.PE459       Location/Qualifiers
FT   CDS_pept        complement(491258..491647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0495"
FT                   /product="crcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67730"
FT                   /db_xref="GOA:C5BH47"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH47"
FT                   /protein_id="ACR67730.1"
FT                   /translation="MNYGLTLLVVACGGALGAISRFQITNWFSSWFGDGFPYATLTVNV
FT                   IGCFIMGALVSMLNSGTLIAPHWRPLIGVGFLGALTTFSTFSFDTFALFSEGFWVKAML
FT                   NVVLNLILCMAAVSAGYYLLLSRSA"
     atgaattatg gtctcacgct gctggtcgtc gcctgcggcg gcgctctcgg tgccattagc        60
     cgttttcaaa tcactaactg gttcagttcg tggtttggcg acggttttcc ctacgccacg       120
     ctcacggtca acgtcattgg ctgctttatc atgggcgcgc tggtctcaat gctgaacagt       180
     ggtaccctaa tcgctccgca ctggcgcccg ctgatcggcg ttggctttct cggcgcgctg       240
     accacttttt ccactttctc tttcgatacg ttcgctctgt ttagcgaagg tttttgggtg       300
     aaggcgatgc tgaacgtcgt gctcaatctg atcctatgta tggcggccgt gagcgcaggt       360
     tattatctgt tactctcccg cagtgcctga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page