(data stored in ACNUC7421 zone)

EMBL: CP001600.PE46

CP001600.PE46        Location/Qualifiers
FT   CDS_pept        complement(44070..44933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0048"
FT                   /product="conserved hypothetical protein TIGR00255"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67308"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9C8"
FT                   /protein_id="ACR67308.1"
FT                   /translation="MIRSMTAYARREVKGNWGSAAWELRSVNQRYLETYIRLPEQFRSL
FT                   EPVIRERLRTRLTRGKVECNLRFELDPSAQSALILNESLAKQLVDAANWVKLQSDEGEI
FT                   NPLDVLRWPGVMAAAEQDLDAISSELLGALDSTIDDFIDAREREGSALKQLIEQRLEAV
FT                   STEVAKVRSRMPEILQWQRERLLSKLEEAQVQLENNRLEQELVLMAQRIDVAEELDRLD
FT                   AHVKETYVILKKKEAVGRRLDFMMQEFNRESNTLASKSINADITASAIELKVLIEQMRE
FT                   QIQNIE"
     atgatccgta gcatgaccgc ttacgcccga cgcgaagtca agggtaactg gggcagcgca        60
     gcctgggagc tgcgctcagt aaaccagcgc tatctggaaa cctatatccg tcttccggag       120
     cagttccgca gtctggagcc ggtgatccgt gaacgcctgc gcacccgcct gacccgcggc       180
     aaggtcgagt gcaacctgcg cttcgagctg gatccgagcg cccagagcgc cctgatcctc       240
     aacgaaagcc tggccaaaca gctggtcgat gccgccaact gggtcaaact gcagagcgat       300
     gagggtgaaa tcaacccgct ggacgtcctg cgctggcccg gcgtgatggc ggccgccgaa       360
     caggatctgg acgccatcag cagcgagctg ctcggcgcgc tggacagcac catcgacgac       420
     tttatcgacg cgcgcgagcg tgagggcagc gccctgaaac agctgatcga acagcgtctg       480
     gaggccgtat cgacagaggt ggccaaggtg cgcagccgga tgccggaaat cctgcagtgg       540
     cagcgcgagc gtctgctcag caagctggag gaggcccagg tacagttgga aaacaaccgt       600
     ctggagcagg agctggtgct gatggcccag cgcatcgacg tggccgaaga gctggatcgc       660
     ctggatgctc acgtgaaaga gacctacgtc atcctgaaaa agaaagaggc cgtcggccgc       720
     cgcctggact ttatgatgca ggagttcaac cgcgagtcga acactctggc ctccaagtcg       780
     atcaacgctg atatcaccgc ctccgccatt gagctgaagg tactgattga gcagatgcgc       840
     gagcagattc agaatattga atga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page