(data stored in ACNUC7421 zone)

EMBL: CP001600.PE460

CP001600.PE460       Location/Qualifiers
FT   CDS_pept        491749..491889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67731"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH48"
FT                   /protein_id="ACR67731.1"
FT                   /translation="MPGVISIGLGEVARYDSSATDIGLCDRLSPTVFNSFVELKVEHHH
FT                   R"
     ttgccaggcg tcatcagcat aggattaggc gaggtcgctc gctatgacag cagtgcgacc        60
     gatatcggct tgtgtgaccg gctatccccg acagttttta attcatttgt tgaattaaag       120
     gtggaacatc atcaccggta g                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page