(data stored in ACNUC7421 zone)

EMBL: CP001600.PE462

CP001600.PE462       Location/Qualifiers
FT   CDS_pept        complement(492848..493192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0498"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67733"
FT                   /db_xref="GOA:C5BH50"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH50"
FT                   /protein_id="ACR67733.1"
FT                   /translation="MIGPGMIGLFSSPYIAIALLCIGGFAHQALSGSLITLSSNIFDRN
FT                   EAATANGLTGMAAWTVSTLFALVSSTLTNTLDFSPRLATLGVFDLLDVLIIWTVLQNCT
FT                   ANDPLSLLPG"
     atgattggcc ccggcatgat cggtctgttc agcagcccgt atatcgccat cgccctcctg        60
     tgcatcgggg gatttgccca tcaggcgctc tctggctcgc tgatcactct ctcctccaat       120
     atctttgacc gcaatgaggc cgccacggcc aacggcttga caggtatggc cgcctggacc       180
     gtcagtacct tgtttgccct ggtgagcagc acattgacca atactctgga cttcagcccg       240
     cgattagcca cgctgggcgt ctttgatcta ttggacgtcc tgatcatctg gaccgtactg       300
     caaaactgta ccgccaacga tccactgtcg ctcctgcccg gctaa                       345
//

If you have problems or comments...

PBIL Back to PBIL home page