(data stored in ACNUC7421 zone)

EMBL: CP001600.PE469

CP001600.PE469       Location/Qualifiers
FT   CDS_pept        499113..499634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0505"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67740"
FT                   /db_xref="GOA:C5BH57"
FT                   /db_xref="InterPro:IPR019629"
FT                   /db_xref="InterPro:IPR026267"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH57"
FT                   /protein_id="ACR67740.1"
FT                   /translation="MNGELLFAQGVGVVAFLIGITTFFNRDERRFRLQLALYSAIIGAH
FT                   FFLMGASAAGMSAELNAIRSVATTRTRNVWIMVLFIALTLGLGSWELKHPVEVLPIAGT
FT                   IVSTWALFRCRGLVTRCLMWCSTACWVIHNLWLGSLGGSLIEGSFLLINGYNIVRFYRM
FT                   QRRGIDPFRS"
     atgaacggtg agcttctgtt tgcccagggg gtaggcgtcg tcgcctttct gatcgggatt        60
     acgacgttct tcaaccgcga tgaacgccgt ttccggctgc agctggcgct gtacagcgcg       120
     atcatcggtg cccatttttt tctgatgggc gccagcgctg ccgggatgag cgccgagttg       180
     aacgcgatcc gttcggtggc gacgacacgc acgcgcaatg tctggattat ggtgctgttt       240
     attgcgctga cccttgggct gggcagctgg gagctgaagc acccggttga agttttgcct       300
     atcgcgggga cgattgtcag cacctgggcg ctgttccgct gtcgtggatt ggtcactcgc       360
     tgcctcatgt ggtgctccac cgcctgctgg gtgatccaca atctgtggct gggctcgctg       420
     gggggctcgc tgatagaggg cagcttcctg ctgatcaatg gctataatat cgtccgcttt       480
     taccgtatgc agcggcgcgg catcgacccc ttccgctcgt ag                          522
//

If you have problems or comments...

PBIL Back to PBIL home page