(data stored in ACNUC7421 zone)

EMBL: CP001600.PE471

CP001600.PE471       Location/Qualifiers
FT   CDS_pept        complement(501338..502306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0507"
FT                   /product="Integral membrane protein TerC family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67742"
FT                   /db_xref="GOA:C5BH59"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH59"
FT                   /protein_id="ACR67742.1"
FT                   /translation="MLNSVGTPWLWGSFALIILIMLAIDLLLQGRRGAQAMTMRQAAVW
FT                   SLVWVSLALLFNAGLWFYLSETLGRAAANQQALAFLTGYLIEKALAVDNVFVWLMLFSY
FT                   FSVPASMQRRVLVYGVLGAIILRTVMIFAGSWLVTQFQWILYLFGAFLLFTGVKMAMAR
FT                   DDEGDLGERPLVRWLRRHLRMTDSIESEHFFTRRSGMLFATPLLLVLILVELSDVIFAV
FT                   DSIPAIFAVTTDPFLVLTSNLFAILGLRAMYFLLAGVAERFTLLKYGLAAILTFIGIKM
FT                   LIVDFYHIPIAFSLGIVAGILALTLLINAWVNHRRTSCALR"
     atgctcaact ctgttggcac cccctggcta tgggggagct tcgccctgat catcctgatt        60
     atgctggcta tcgatctact gctgcaggga cggcgtggcg cccaggcgat gaccatgcgc       120
     caggccgcag tctggtcgct ggtctgggtc agcctggcgc tgttgttcaa cgccggtctt       180
     tggttctatc tgagtgaaac cctggggcgg gcggcggcca atcagcaggc gctggcattc       240
     ctcaccggct atttgatcga aaaggcgttg gcggtcgata acgtctttgt ctggctgatg       300
     ctgttcagct atttctccgt tccggccagc atgcagcgcc gggtgctggt ctacggcgta       360
     ctgggggcga taatcctgcg aacggtaatg atcttcgccg gtagctggct ggtgacccag       420
     ttccagtgga tcctctacct gtttggcgct ttcctgctgt ttaccggcgt taagatggcc       480
     atggcccgcg atgacgaagg cgatctcggc gaacgcccgc tggtacgctg gctacgccgc       540
     cacctgcgga tgaccgacag cattgaaagc gagcacttct ttacccgccg cagcggtatg       600
     ctgttcgcca ccccgctgct gctggtgctg atcctggtcg agctgagcga cgtgatcttt       660
     gccgtcgaca gcattccggc aatatttgct gtgaccaccg atccgttcct ggtgctgaca       720
     tccaatctgt ttgccattct ggggctgcgc gccatgtact tcctgctggc cggcgtggcc       780
     gagcgcttta ccctgttaaa gtacgggctg gcagccattc tgaccttcat cggcatcaaa       840
     atgctgatcg tcgatttcta ccatattccc atcgccttct ctctgggtat cgtcgccggg       900
     atcctggcgc tgactctact gatcaacgcc tgggtcaacc atcgccgcac atcgtgcgct       960
     ctccgataa                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page