(data stored in ACNUC7421 zone)

EMBL: CP001600.PE472

CP001600.PE472       Location/Qualifiers
FT   CDS_pept        502691..503599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0509"
FT                   /product="Integral membrane protein DUF6"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67743"
FT                   /db_xref="GOA:C5BH60"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH60"
FT                   /protein_id="ACR67743.1"
FT                   /translation="MEVARKTNLLAIAGLIALTLIWSYNWIAMKQVTQYIGAFDFTALR
FT                   CVCGALLLLLVLRLRGHGMRPTPFGYTLAIALLQTCGMVGLAQWALMSGGAGKVAILSY
FT                   TMPFWVVIMAALFLGERMRRLQYAAIAVAALGLLLVLQPWKLDLSSLKSALLAVLSGIS
FT                   WGASAIVAKRMYARYPGVDLLGLTTWQMLYAAVVMSAVAWLVPQRSVDWQPYVFWALAY
FT                   SAILATALAWSLWLFVLKNLSAGIASLSTLAVPVCGVLFSWWLLGEDPGPVEGSGIVLI
FT                   VLALAAISIKRQGPQAQSTRR"
     atggaagttg caagaaaaac caatctactg gcgatagcgg gcctgatcgc cctgacgctg        60
     atctggagct acaactggat tgcgatgaaa caggtaacgc agtatatcgg ggcgttcgac       120
     tttaccgcgc tgcgctgcgt ctgcggcgcg ctgttgctgc tgctggtact gcgtctgcgc       180
     ggacacggta tgcggccgac gccgtttggc tatacgctgg ccatcgcgct gctgcaaacc       240
     tgcggtatgg ttgggctggc tcagtgggcg cttatgagcg gcggtgccgg taaggtggcg       300
     atcttaagct ataccatgcc gttttgggtg gtgatcatgg ccgccctgtt tcttggcgag       360
     cggatgcggc gcctgcagta tgccgcgatt gcggtagcgg ccttgggatt gctgctggtg       420
     ctgcagccgt ggaagctgga tctctcctcg ctgaaaagtg cgctgctggc ggtgctctcc       480
     ggcatcagtt ggggggcgag cgccatcgtg gccaaacgta tgtacgcccg ctatccaggc       540
     gttgatttgc tggggctaac gacctggcag atgctgtatg ccgccgtggt gatgagtgca       600
     gtggcttggc tggtgccgca gcgcagtgtg gactggcagc cctatgtgtt ctgggcgttg       660
     gcctacagtg cgattctggc gacggcgctg gcctggagcc tgtggctgtt cgtgttgaaa       720
     aacctgtcgg ccgggatcgc cagcctgagc accttggcgg taccggtctg cggggtactg       780
     ttttcctggt ggctgctggg tgaggatccg ggcccggtag aggggagtgg tatcgtgctg       840
     atcgtgctgg cgctggcggc gattagcatc aagaggcagg ggcctcaggc gcagagcacc       900
     cgtcgatag                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page