(data stored in ACNUC7421 zone)

EMBL: CP001600.PE474

CP001600.PE474       Location/Qualifiers
FT   CDS_pept        complement(504664..505167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0511"
FT                   /product="hypothetical protein"
FT                   /note="Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67745"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH62"
FT                   /protein_id="ACR67745.1"
FT                   /translation="MTHLSYLVGYPEPLLAQVRTLLEQKRLGDTLRRRYPERHAITTDR
FT                   ALYDYAQRLKNHYMRNTPPLSRVQYDSRIQVIQQALGLHRAVSRVQGNRLKAKAEIRIA
FT                   SLFRQGPEALLRMIVVHELAHLREKNHDKAFYSLCCHMEPNYHQLEFDARLYLTCLDVE
FT                   GSVY"
     atgacgcacc tgagttacct ggtcggatat ccggagcccc tgctggcgca ggttcgtacc        60
     ctgttggagc aaaagcgcct gggcgatacg ctgcggcgcc gctaccccga gcgccatgcg       120
     atcacgacgg accgggcctt atatgactat gcacaacgcc tgaaaaatca ctatatgcgc       180
     aataccccac cccttagccg ggtgcaatac gatagccgca ttcaggtgat ccagcaggcg       240
     ctcggcctgc accgcgccgt atctcgcgtt cagggcaacc ggctgaaggc caaagcggag       300
     atccgtatcg ccagcttgtt ccgccagggg ccggaggccc tgctgcgaat gatcgtggtg       360
     catgagctgg cccatctgcg cgaaaaaaat cacgataagg ccttctacag tctgtgctgc       420
     catatggagc ccaactacca ccagctggag tttgatgccc ggctctacct gacctgcctg       480
     gatgttgagg gaagcgtata ttga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page