(data stored in ACNUC7421 zone)

EMBL: CP001600.PE475

CP001600.PE475       Location/Qualifiers
FT   CDS_pept        505245..506390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0512"
FT                   /product="methyltransferase, small subunit domain protein"
FT                   /note="methyltransferase, small subunit domain"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67746"
FT                   /db_xref="GOA:C5BH63"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017237"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH63"
FT                   /protein_id="ACR67746.1"
FT                   /translation="MSQLESSAGCPAITDLTLARFPHQSDDPSLQAWEAADEYLLQQID
FT                   PTQAQGRPTIIFNDAFGALACALHALRPYSVSDSYVSQLATRHNLQLNDLDGDAVTLLD
FT                   SLSPLPEAPALVVIKLPKMLALLEQQLHALRAVVAPDTRIIAAAKARDIHTSTLQLFES
FT                   ILGETHTSLAWKKARLIYCQVAERTVIPAPATTVWPLEGTPYTMHNHAGVFSRGSLDIG
FT                   ARFFLQHLPEGLQGEVADLGCGNGVLGLAALSGSPQARVLFADESYMAVASAHLNVQHN
FT                   RPQDLARCEFWVGNGLAGREGGTLDAVLCNPPFHQQHSITDQVAWDMFVAARRCLKRNG
FT                   VLYIVGNRHLDYYPKLRRLFGNCTTLGMNRKFVVLKAVKTV"
     atgagccaac tcgaatccag cgccggttgt ccggctatca ccgacctgac gctggcgcgt        60
     tttccccatc agtctgacga tccttccctg caggcctggg aggccgcaga cgaatacctg       120
     ctacagcaga tcgatccgac ccaggcgcag ggacgcccga ccatcatctt taacgatgcc       180
     tttggcgcgt tggcctgcgc tctgcacgct ctgcgtccct actcggtgag cgactcctac       240
     gtcagccagc tggcgacgcg ccataatctg cagcttaatg atctggacgg ggatgccgtt       300
     accctgttag acagcctgag cccactgccg gaggcccccg cgctggtggt gattaagctg       360
     cctaaaatgc tggcgttgct ggagcaacag ctgcatgcgc tgcgggcggt ggtcgcgccg       420
     gatacccgta ttatcgccgc ggccaaggcg cgtgatattc atacctcgac cctacagctg       480
     tttgagtcga tcctggggga gacacatacc tctctggcgt ggaaaaaggc ccgcctgatt       540
     tactgtcagg tggctgagcg cacggtgata ccggcgccgg ctacgaccgt ttggccactg       600
     gagggtacac cttacaccat gcataatcat gcgggtgtat tctcccgtgg cagtctggat       660
     atcggtgcgc gctttttcct gcagcatctg ccggaggggc tacagggcga ggtggccgat       720
     ctgggctgtg gcaacggcgt actggggctg gcggcgctga gcggcagccc gcaggcccgg       780
     gtactgtttg ccgatgaatc ctatatggcg gtggcctcgg cgcatctgaa cgtgcagcat       840
     aaccgtccgc aggatttggc gcgctgtgag ttctgggtcg gtaacgggct ggcggggcgc       900
     gaaggcggca cgctggatgc cgtgctgtgt aacccgccgt ttcatcagca gcattcgatt       960
     accgatcagg tggcgtggga catgttcgtc gccgcgcgtc gctgtttgaa acgcaatggg      1020
     gtgctgtata tcgtcggcaa ccgtcacctg gactattatc cgaagctgcg ccgcctgttt      1080
     ggcaactgca ccactctggg aatgaaccgt aaatttgtgg tgctcaaggc ggtgaaaacg      1140
     gtctga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page