(data stored in ACNUC7421 zone)

EMBL: CP001600.PE477

CP001600.PE477       Location/Qualifiers
FT   CDS_pept        complement(507768..509132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0514"
FT                   /product="sensory histidine kinase QseC, putative"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67748"
FT                   /db_xref="GOA:C5BH65"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH65"
FT                   /protein_id="ACR67748.1"
FT                   /translation="MRHLPRQLTHSLRARLTGGFLILVLLVWSSASALTWYQTRDALNE
FT                   LFDTQQMLFAKRLLAFDLSQLKHPLQLPQSHDLLHKHRGDQDKDALAFAIFNADGRMLL
FT                   NDGDNGDNLVYRYQGDGFTDGYLDNDDDSWRLLWLTTPDGRYRILVGQEWDYRNDMALS
FT                   IVGGQMIPWLVALPVMVILLLLVVSRGLAPLHRLAAALGRRRPDDATPLPRDAIPSEVW
FT                   PVVESLNTLFSRTNAQMVRERRFTSDAAHELRTPLAALRVQAEVVQLAQDDIALRQRAL
FT                   GQLEQGIDRATRLVDQLLTLSRLDSLSQLDDVQPRVLAELLQTAVIDMDAKAHAAGVAL
FT                   ALSVDDPKVRRRIQPLLFSLLIRNLLDNAICYSPAGSQVTLRLTSHRLQITDNGTGVSD
FT                   AVLQRLGERFYRPPGQEKTGSGLGLSIVRQIASLHEMQVQFSHAPGGGFQVTLRW"
     atgcgccatc ttccccgcca gctgacccac agcctgcgtg ccaggctgac cggaggcttt        60
     ttgatcctgg tactgctggt ctggagcagc gccagcgccc tgacctggta tcagacgcgc       120
     gatgcgctca acgagctgtt cgatacccag cagatgctgt ttgccaagcg cctgctggcc       180
     tttgatctca gtcagctgaa gcacccactg cagctgccgc aaagccatga tttgctacat       240
     aagcaccgcg gtgatcagga caaggacgcg ctggcgttcg ccatcttcaa tgccgatgga       300
     cgcatgctgc tcaacgatgg ggacaacggc gataatctgg tgtatcgcta ccagggggac       360
     ggctttaccg atggctatct ggataacgac gatgacagct ggcgactgtt gtggctcact       420
     accccggacg ggcgctaccg gattttagtc ggccaggagt gggactatcg caacgacatg       480
     gcgctgagca tcgtcggggg acagatgata ccctggctgg tggcgttgcc ggtcatggtg       540
     atcctgctgc tgctggtggt cagccgcgga ctggctccct tgcaccgact ggcagcggcg       600
     ctgggacgcc gccgcccgga cgatgccacc ccgttacccc gcgatgccat ccccagcgag       660
     gtctggccgg tggtagagtc actcaatacc ctgttttccc gaaccaatgc acagatggta       720
     cgcgagcggc gctttacctc tgacgctgcc catgagctac gaaccccact ggcggcgtta       780
     cgggttcagg ccgaagtggt acaactggcg caggatgata tcgccctgcg tcagcgtgcg       840
     ctgggccagc tggagcaggg tatcgatcgt gcgaccaggc tggtggatca gctgttgacc       900
     ctgtcgcgcc tcgactcgct gtcccagctg gatgatgtac agccacgggt gctggccgag       960
     ctcctacaga cagcggtgat cgacatggac gcgaaggccc atgctgccgg ggttgctctg      1020
     gcgctgtcgg tggatgatcc caaggtgcgc cgacgtatcc agccgctgct gttctctctg      1080
     ttgatccgca acctgctgga taacgcgatc tgctacagcc cggcaggcag ccaggtcacc      1140
     ctgagactga ccagccatag gctgcagatc accgataatg gcaccggcgt cagcgatgcc      1200
     gtgctgcagc gcttgggcga gcgcttttac cgcccgccgg gccaggagaa aaccggcagt      1260
     ggactgggtc tctccatcgt ccgtcagata gcctctctgc acgaaatgca ggtacagttc      1320
     agccacgcac cgggtggggg atttcaggtc acgctgcgct ggtaa                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page