(data stored in ACNUC7421 zone)

EMBL: CP001600.PE479

CP001600.PE479       Location/Qualifiers
FT   CDS_pept        510004..510405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0516"
FT                   /product="Protein unknown function (DUF388)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67750"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR016052"
FT                   /db_xref="InterPro:IPR036700"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH67"
FT                   /protein_id="ACR67750.1"
FT                   /translation="MKKGAAIFAILALCSAPVLAQTGGFSGPGAMQQAQDTQQSGGFVS
FT                   GQQAVTTVAKAKDLSDNSWVVLQGNIEQRVRGDHYTFRDATGTIEVEIDHKYWNGQTIT
FT                   PKDKVEIQGEIDKDWSTTKIDVKRLHKMN"
     atgaaaaaag gtgctgctat ttttgctatt ctggccctgt gcagtgcacc ggttctggct        60
     cagacagggg gattctctgg cccgggtgcg atgcaacagg ctcaggatac ccagcagagc       120
     ggcggttttg tcagcggcca acaggcggta accaccgtgg cgaaggcgaa agatctcagc       180
     gataacagtt gggttgtgct gcagggtaat attgaacagc gcgtgcgcgg cgatcactat       240
     actttccgcg atgccaccgg caccattgaa gttgagatag atcataagta ctggaacggg       300
     cagaccataa cgccgaaaga caaggtggag atccagggtg agatcgataa ggattggagc       360
     accaccaaga ttgatgttaa gcgcctgcat aagatgaact ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page