(data stored in ACNUC7421 zone)

EMBL: CP001600.PE482

CP001600.PE482       Location/Qualifiers
FT   CDS_pept        513562..514887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0519"
FT                   /product="restriction modification system DNA specificity
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67753"
FT                   /db_xref="GOA:C5BH70"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH70"
FT                   /protein_id="ACR67753.1"
FT                   /translation="MANYKAYPEYKDSGVEWLGLVPESWTICRLKNLAAIKNGQDYKSV
FT                   QTDDGYPVMGSGGQFTFASKFMYDKPSVLLGRKGTIDKPLYINEPFWTVDTMYYTELNE
FT                   GFDARYLYYLALTIQFSRYSTNTALPSMTQEHLSNYKFSVPKAESERKKITKFLDHETA
FT                   KIDNLIEKQQQLIELLKEKRHAVISHAVTKGLNPDVPMKDSGVEWLGEVPEHWTISTLK
FT                   HHAKFIDGDRGSEYPNDNDLVDDGVVFLSSKNISNWEINIDDANYISREKFNRLNRGKA
FT                   INGDVIVKVRGSTGRIGELAIFETERLNKSTAFINAQMMIIRLKNSFNNRFLCNVAQGH
FT                   YWMEQLNVGAYGTAQQQLNNAIFSGMIMVVPPIDEQLTINKFLELEIKRFDGLIKNTSN
FT                   MIQLIQERRTALISAAVTGKIDVRDWVAPDTQEAEEPQEVSA"
     atggctaact ataaggcgta tccggagtat aaggattctg gagttgagtg gctggggcta        60
     gtgcctgagt cttggactat ttgtagattg aaaaacttgg cggcaataaa aaatggccag       120
     gattataaat ctgttcaaac tgatgatggc tatccagtta tggggtcagg tggacagttt       180
     acgttcgcat ctaaatttat gtatgacaag ccatctgtat tacttggacg caagggaact       240
     atcgacaagc cattatatat aaatgagcca ttctggactg ttgatacaat gtattacacg       300
     gaattaaatg aaggttttga tgcaagatat ctttattatc ttgcactcac gatacagttt       360
     tctcgttatt ctacaaatac agccctgcca agtatgactc aggagcactt gagtaattat       420
     aaattttccg taccaaaggc tgaatcagaa cggaagaaaa taactaagtt tttagatcac       480
     gaaaccgcaa aaatcgacaa cctgatcgag aagcaacagc aactgattga actgctgaaa       540
     gaaaagcgcc atgcagtgat tagtcatgcc gttaccaaag ggctaaaccc tgatgtgccg       600
     atgaaagact ctggtgttga gtggttgggg gaagtgccgg agcattggac tatttccaca       660
     ttaaaacatc atgcaaaatt tatcgatggt gacagaggaa gtgagtatcc taatgataat       720
     gatcttgtag atgatggagt tgttttcctt tcttcaaaga acatttctaa ttgggagata       780
     aatattgatg atgcaaatta tatttctcgc gaaaaattca atcgcctaaa tagaggtaaa       840
     gctataaacg gtgatgtaat tgttaaagtt agagggagca cggggcgaat cggtgagtta       900
     gctatttttg aaactgagcg gttaaataaa agcactgcct ttataaatgc ccaaatgatg       960
     attattagat taaaaaatag tttcaataat cgttttttgt gtaatgttgc acaaggtcat      1020
     tattggatgg aacaattaaa tgtcggcgca tatggaactg ctcagcaaca actaaataat      1080
     gctattttct caggtatgat tatggttgtt cctcctatag atgaacagtt aacaattaat      1140
     aaatttttag aattagagat taagcgcttt gatggtctga ttaaaaatac atctaatatg      1200
     attcaactta ttcaggaacg ccgcaccgcc ctaatctccg ccgccgtcac cgggaaaatc      1260
     gacgtccgcg actgggttgc gccagataca caggaagcag aggagccaca ggaggtcagc      1320
     gcatga                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page