(data stored in ACNUC7421 zone)

EMBL: CP001600.PE483

CP001600.PE483       Location/Qualifiers
FT   CDS_pept        514884..518132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0520"
FT                   /product="Type III restriction enzyme, res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67754"
FT                   /db_xref="GOA:C5BH71"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH71"
FT                   /protein_id="ACR67754.1"
FT                   /translation="MSMDSTKERIFQDEMIAQMIDRGWVRGKTDGYDRERALYSQDALT
FT                   FVQTTQPQEWEKFTKVYPSDTERHFLDALVAQLKKADINATDMLSRTYGTLGVLRHGIK
FT                   SHNARFSLCQFKPEHNLNPQTLTRYQQNICRLVPELVYSPHASNGAFAETGVKAKKWRI
FT                   DLVLFVNGLPIATLELKSEFKQTVQNAITQYKKTRLPKDPGTNKPEPLLTFKRGALVHF
FT                   AVSQYDVFMTTRLDGDKTFFLPFNKGTHDGGAGNDIPEDANDYATSYLWKEVLLPDNLL
FT                   KILASFMHLQIVEKENALGLKYKSESLIFPRYHQWDVVNKLITAATVEGTGNKYLIQHS
FT                   AGSGKSNSIAWTAHQLSRLYDENGEKQFHSVIVVTDRTVLDDQLQDTIYQFEHQDGVVG
FT                   RINNKEGDGSKSEKLASALENSQPIIIVTIQTFPFVLKAIENSVSLKQRKYAVIADEAH
FT                   SSQSGSTARQLKEVLMTEEADDDVEMSSEDILDATVAARRGSSNLNYYAFTATPKAKTL
FT                   ELFGRRPNPLEPASKTNKPEAFHVYSMRQAIEEGFILDVLKNYTNYKVAYKLLQKLGDP
FT                   DREVDSKKAKVKLNQWVSLHDYNVSQKVRVIVEHFRQHVMHLLAGQAKAMVVTSSRKAA
FT                   VRYKLAFDKYIAERKYAKISAMVAFSGEVEFHEDDHNSLALLHQKFTEINMNPGLKGRD
FT                   MRKAFDTDEYQVMLVANKFQTGFDQPKLCAMYVDKKLGGVECVQTLSRLNRTYPGKAQS
FT                   GTFVLDFYNEPEDILGAFQPYYQTAELTDVSDPQLVFELYEKLRTSGIFLWNEVEQFCT
FT                   AFFSKNKSNAAISNICKPAVQRWKNRYTSAIDAYLLAKEMFERTRKTGDIVLITNAENT
FT                   FKECEKEKSKLDIFKKDLGSFVRFYEFMSQIVDYDDKNLEKLSLFARHLRPLLHEQRIE
FT                   EDEIDLSNVEMSHYRLSKLHEQHLKLQEDAEDDKIKPGNEVGTAKPKDKKEEFLSNILA
FT                   RLNELFVTDNLTDKDMINYAFAVRDKLSENQAVMTQIANNTREQAMLGDFPQAIDDAVM
FT                   DSNDAQQEMMLQYLSNPELAKGFARVVFDMLKGA"
     atgagcatgg acagcaccaa agagcggatt ttccaggatg agatgatcgc acagatgatc        60
     gatcgtggct gggttcgcgg caaaaccgac ggctacgatc gcgaacgtgc gctgtactcg       120
     caggatgcac tgacctttgt gcagaccacc cagccgcagg agtgggagaa gtttaccaaa       180
     gtttatccca gcgataccga gcgtcatttc ctcgatgcgc tggtggcgca gctaaaaaaa       240
     gcggatatca atgccaccga tatgctgtcg cgtacctacg gtaccctcgg cgtgctgcgt       300
     catggcatca agagccacaa tgcgcgcttc tccctgtgcc agtttaagcc ggaacataac       360
     ctcaatccgc aaaccctgac gcgctaccag cagaatatct gccgcctggt gccggagctg       420
     gtttatagcc cgcatgcctc gaacggcgcc tttgcagaaa ccggcgtcaa ggccaagaaa       480
     tggcgtatcg atctggttct gttcgtcaat ggcctgccga tagcgaccct ggaactgaag       540
     tctgaattta agcagacagt gcaaaacgcc attacgcaat ataagaaaac gcgtttgccc       600
     aaggatcccg gcaccaataa acccgaaccg ctgctgacct ttaaacgtgg ggcgctggtg       660
     cattttgccg tcagccagta cgacgtgttt atgacaacca gactcgacgg cgataaaacc       720
     ttcttcctgc cgtttaataa aggcacccat gacggcggtg cggggaacga catcccggaa       780
     gatgccaacg actatgcgac cagttacctg tggaaagagg tgctgctgcc ggacaatctg       840
     ctgaaaattc tcgccagttt tatgcatctg caaatcgtcg aaaaagagaa cgcccttggc       900
     ctgaagtaca aaagcgagag cctgattttc ccacgctatc accagtggga tgtggtgaac       960
     aaactgatca ccgccgccac ggtggaaggc accggcaata aatacctgat ccagcacagc      1020
     gcggggtcgg gcaaatcgaa ctctatcgcc tggacggccc atcagctttc ccgcctgtac      1080
     gatgaaaatg gcgagaagca gttccactcg gtgattgtgg tgacggaccg caccgtgctc      1140
     gacgatcagc tgcaggacac catctatcag ttcgagcatc aggatggcgt ggtcgggcgg      1200
     atcaataaca aggaaggcga cggttcaaaa tcggagaagc tggccagcgc gctggaaaac      1260
     tcacagccga tcattatcgt caccatccag accttcccgt ttgtcctgaa ggcgattgaa      1320
     aacagcgtca gcctcaagca gcgtaaatat gcggtgattg ccgatgaagc gcactcctcg      1380
     cagagcggct caacggcgcg acagctgaaa gaggtgctga tgaccgaaga ggcggatgac      1440
     gatgtggaga tgtcctcaga ggatattctg gatgccaccg tcgccgcgcg tcgaggcagc      1500
     agcaacctca actattacgc cttcaccgcc acaccgaaag ccaaaaccct ggagctgttt      1560
     ggccgtcgcc cgaatccgct ggagccggca tcgaaaacca acaaaccgga agcgttccac      1620
     gtttactcca tgcgtcaggc catcgaagag ggctttattc ttgatgtgct gaagaactac      1680
     accaactaca aggtggcgta caagctgctg caaaagctgg gcgatcctga ccgggaagtg      1740
     gacagcaaga aagccaaggt caaactgaac cagtgggtct cgctgcacga ttataacgtg      1800
     tcgcagaagg tgagggtgat cgttgaacac ttccgccagc atgtgatgca cttactggcc      1860
     ggtcaggcca aagcgatggt ggtgaccagc tcgcgtaaag cggcggtgcg ttacaagctg      1920
     gcgttcgata aatacatcgc cgagcgcaag tacgccaaga tcagcgcgat ggtggcgttc      1980
     tccggggaag tggagttcca cgaagatgac cacaacagcc ttgcgctgct tcatcagaag      2040
     ttcaccgaga tcaatatgaa cccgggcctg aaaggccggg atatgcgtaa agcgtttgat      2100
     accgatgagt accaggtgat gctggtggcc aacaaattcc agaccgggtt tgaccagccc      2160
     aagctgtgtg ccatgtatgt ggataagaag ctgggcggcg tggagtgtgt acagaccctg      2220
     tcgcgcctga accgtaccta tcctgggaag gcgcagtccg gcacctttgt gctcgatttc      2280
     tacaatgagc ctgaagatat tttgggggct ttccagccct actaccagac cgcagaactg      2340
     acggatgtca gcgatccgca gttggtcttt gaactttatg aaaagctgcg taccagcggc      2400
     attttcctat ggaacgaagt ggagcagttc tgcacggcgt tcttcagcaa aaacaaatcc      2460
     aacgcggcca ttagtaatat ctgcaaaccg gcggtgcagc gctggaaaaa ccgctacacc      2520
     tcggcgattg atgcctatct gctggccaaa gagatgtttg aacgcaccag gaagaccggc      2580
     gatattgtgc tgatcaccaa cgcggaaaac accttcaaag agtgcgagaa agaaaaaagt      2640
     aagctggata tcttcaagaa agatctcggc agctttgtcc gcttttacga gtttatgtcg      2700
     caaatcgtcg attacgacga caagaacctg gaaaagctga gcctgtttgc ccgccatctg      2760
     cgtccgttgc tgcatgaaca gcgtatcgaa gaagacgaga ttgatttaag caacgtggag      2820
     atgagccatt atcgcctgtc gaagctccac gaacagcatc tgaagctgca agaggatgca      2880
     gaagatgaca aaatcaaacc gggtaatgag gtcggtacgg cgaagccgaa ggacaagaaa      2940
     gaggagtttc tgtcgaatat cctggcccgc cttaatgagc tttttgtcac cgataatctc      3000
     accgataaag acatgattaa ttatgccttc gcggtgcgtg acaagttgtc agaaaaccag      3060
     gcggtgatga cccagatcgc caacaatacg cgcgaacagg cgatgctggg cgatttccca      3120
     caagccattg atgatgccgt gatggacagc aacgacgccc agcaagagat gatgctgcaa      3180
     tacctctcta accctgagct ggcgaaaggc tttgcccggg tggtatttga tatgttgaaa      3240
     ggggcttaa                                                              3249
//

If you have problems or comments...

PBIL Back to PBIL home page