(data stored in ACNUC7421 zone)

EMBL: CP001600.PE490

CP001600.PE490       Location/Qualifiers
FT   CDS_pept        complement(524921..525589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0528"
FT                   /product="conserved hypothetical protein TIGR00023"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67761"
FT                   /db_xref="GOA:C5BHG2"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHG2"
FT                   /protein_id="ACR67761.1"
FT                   /translation="MSATALGMIIFAYLCGSISSAILVCKAAGLPDPRENGSGNPGATN
FT                   VLRNGGRLAAAAVLIFDVLKGMIPVWLAYTLEMSPFYLGLTAIAACLGHIYPVFFRFRG
FT                   GKGVATAFGAIAPIGWDLTGLMVGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFT
FT                   FPVAMLSCLILVRHHDNIQRLWRGKEGKIWRKKGAKSAQNSERPASASPPHDDEPQTPR
FT                   "
     atgagtgcga ctgcgttagg catgattatt ttcgcctacc tgtgcggctc catctccagc        60
     gccattctgg tttgcaaagc ggccggactc cccgacccga gggaaaatgg ttctggtaat       120
     cccggagcaa ccaacgtgct gcgcaacggt gggcgcttag ccgccgccgc cgtactgatc       180
     ttcgatgtac ttaaggggat gatcccggtc tggctggcct atacgctgga gatgtccccc       240
     ttttacctcg gcctgacggc cattgcagcc tgtctgggcc atatttaccc ggtattcttt       300
     cgcttccgcg gcggtaaagg cgtcgcgacc gcctttggcg ccatcgcccc catcggctgg       360
     gatctgaccg gactgatggt cggcacctgg ctgctgaccg tgctattgag cggatactcc       420
     tcccttggcg ccatcgtcag cgcgctgatc gcccccttct acgtctggtg gtttaagccg       480
     cagtttacct tcccggtggc catgctttcc tgtcttatcc tggtgcgtca ccacgataat       540
     atccagcgtc tatggcgtgg aaaagaggga aaaatctgga ggaaaaaggg cgctaaaagc       600
     gcccagaata gcgagaggcc agcctcagcc tcgccccccc atgatgacga accgcagacg       660
     ccgcgctga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page