(data stored in ACNUC7421 zone)

EMBL: CP001600.PE495

CP001600.PE495       Location/Qualifiers
FT   CDS_pept        complement(529221..530486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0533"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67766"
FT                   /db_xref="GOA:C5BHG7"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHG7"
FT                   /protein_id="ACR67766.1"
FT                   /translation="MEIIANHGSLLIMVAAFFGLLMAIGIGANDVANAMGTSVGARAVT
FT                   IRQAIVIAMIFEFAGAYLAGGEVTQTIRSGIIDTNAFAGHPQTLVFGMMASLLAAGIWL
FT                   IVASLMGWPVSTTHSIIGAIIGFACVSVGPEAVEWDGVKGIVGSWIITPLISGVVAYGI
FT                   FLSAQRLIFNTENPFANARRFGPVYMFLTALVISLVTIKKGLKHVGLHLTDGETWLISL
FT                   LVSLLVMLGGYLYLSRKSFTDDADEQDHFRGVERVFSLLMVITACAMAFAHGSNDVANA
FT                   IGPLSAIVAIVRDPSVLAGTSPIVWWILPLGGIGIVVGLALMGRRVMETVGTGITDLTP
FT                   SRGFAAQFATASTVVIASGTGLPISTTQTLVGAVLGVGFARGIAALNLNVVRNIVASWI
FT                   VTLPAGAALSIALFYLLQAVFG"
     atggaaatca ttgccaatca cggctcatta ctgatcatgg tggcggcctt ctttggcctg        60
     ctgatggcta tcggcatcgg cgccaacgac gtcgccaacg cgatgggaac ctccgtaggc       120
     gcccgcgccg tcaccatccg tcaggcgatc gtcatcgcca tgatcttcga attcgccggc       180
     gcctacctgg ccggcggtga agtcacccaa accatccgca gcggcatcat tgataccaat       240
     gccttcgccg gtcatcccca gacgctggtc ttcgggatga tggcctcgct gctggccgcc       300
     ggcatctggc tcatcgtcgc ctcgctgatg ggctggcctg tctccaccac ccactccatc       360
     atcggtgcca tcatcggctt tgcctgcgta tctgtcggcc ccgaagcggt cgaatgggac       420
     ggcgttaagg ggatcgtcgg cagctggatt atcacaccgc tgatctccgg ggtggtggcc       480
     tatggcattt tcctcagcgc ccagcggctg atttttaaca ccgaaaaccc cttcgctaac       540
     gcccgccgct ttggcccggt gtatatgttc ctgaccgcgc tggttatctc gctggtcacc       600
     atcaagaaag gattaaagca cgtcggcctg cacctgacgg acggggagac ctggctgatt       660
     tcactgttgg tctctctact ggtcatgctc ggcggctatc tgtatctgtc gcgcaaatcc       720
     tttaccgatg acgccgatga gcaggatcac ttccgcggcg ttgagcgggt attcagtctg       780
     ctgatggtca tcaccgcctg cgccatggct tttgcccacg gctctaacga tgtcgccaac       840
     gccattgggc cgctgtctgc catcgtcgcc atcgtgcgcg atccgagcgt gctggccggc       900
     acctctccca tcgtctggtg gatcctgccg ttgggtggta tcggtatcgt tgtgggtctg       960
     gcgctgatgg gccgtcgcgt catggaaacc gtgggcaccg gtattaccga tctcaccccg      1020
     agccgtggct ttgccgccca gttcgccacc gcctcaacgg tggtgatcgc ctccggtacc      1080
     ggcctgccga tctccaccac ccagacgctg gtcggcgccg tgctgggcgt cggttttgcc      1140
     cgcggtattg cggcactgaa ccttaacgtg gtacgtaaca ttgtcgcgtc atggattgtg      1200
     accctgcccg cgggagccgc gctctccatt gctctgtttt atctgctgca ggcggtcttc      1260
     ggctaa                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page