(data stored in ACNUC7421 zone)

EMBL: CP001600.PE496

CP001600.PE496       Location/Qualifiers
FT   CDS_pept        complement(530509..531192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0534"
FT                   /product="conserved hypothetical protein TIGR00153"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67767"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHG8"
FT                   /protein_id="ACR67767.1"
FT                   /translation="MMPVNTILGLFAKSPLKPLQEHASRVHECCSLLVPFFAATAQQQW
FT                   DQAQEIREQISNLEKQADTLKREIRLKLPRGLFLPVDRGDMLELVTQQDRLANRAKDIA
FT                   GRVIGRRLQIPAVMQADFVSYLQRCLDATALSSKVIHEMDELLETGFRGREADLVEQMV
FT                   MELDHIEDDTDHQQILLRQTLLSLEHQLNPVDIMFLYQIIEWVGGLADKALRVGSRLEL
FT                   MLARS"
     gtgatgccag taaatactat tttaggcttg tttgccaagt ctccgctcaa accgcttcaa        60
     gagcacgcca gccgcgtgca cgaatgctgt agcctgctgg ttcccttctt tgccgccacc       120
     gcgcagcagc agtgggatca ggcgcaggag atccgtgaac agatctccaa cctggaaaag       180
     caggctgaca cgctgaaacg cgaaatccga ctgaaattac cacgcggtct ttttctgccg       240
     gtcgatcgcg gtgacatgct ggagctggtt acccaacagg atcgtctggc caaccgtgcc       300
     aaggacatcg ccgggcgggt catcggccgt cgcttgcaaa tccccgccgt catgcaggct       360
     gactttgtga gctacctgca gcgctgcctg gatgcgaccg cactctccag caaagttatt       420
     cacgaaatgg atgaactgct ggagaccggc tttcgcggcc gcgaagccga tctggtcgag       480
     cagatggtga tggaactgga tcatatcgaa gatgataccg accatcagca gatcctgtta       540
     cgccagaccc tgctctccct tgagcaccag ctcaaccctg tcgacatcat gtttctctat       600
     caaatcattg agtgggtcgg cggccttgcc gataaagcgc tgcgcgtagg ttcccggctg       660
     gaactgatgc tggcccgtag ttaa                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page