(data stored in ACNUC7421 zone)

EMBL: CP001600.PE497

CP001600.PE497       Location/Qualifiers
FT   CDS_pept        531328..532644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0535"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67768"
FT                   /db_xref="GOA:C5BHG9"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHG9"
FT                   /protein_id="ACR67768.1"
FT                   /translation="MTEKMTVEIELKFIALPSAVHELPASLARWPLQHTPAQALSNIYY
FT                   ETECQTLRRHDMGLRIRGCDGAYEMTLKTAGSDVGGLHQRPEYNVALDAPQLDLRRFPA
FT                   QVWPDGCDVDALQAALQPLFSTDFQRERWVVTYRESQIEVALDRGDICAAGEREALHEI
FT                   ELELLQGERGDLLAFAEQLLTLDGIRMGAMSKAARGYRLAAGNAALRRRAFPLLRPAVR
FT                   ASVEQGMSAALTQILAHWQYHEEAWLRGDAESRDGIQEALVALRQSLTLFGGIVPRKAS
FT                   ATLRAGLSALEAQIQQPACAAQTLCYGRESLTTQWALTRWLAESGWRAYLDAAGSAKLS
FT                   GSFKRFADIMLGRCGAELKALFALVRHPQEYQDKLPRLQHQILAIRLLGGAYGEAAVDG
FT                   YLAPWQTLAHAIAHPAAATPEAACAQALHQPAFWRNGAH"
     atgacagaaa aaatgaccgt ggaaattgaa ctgaaattca tcgccctccc gtccgctgta        60
     cacgaattgc ccgcgagtct ggcccgctgg cctcttcagc atacgcccgc ccaagcactg       120
     agcaatatct attatgagac ggaatgtcag actttacgcc gccatgatat gggactgcgg       180
     atccgcggat gcgatggcgc ctatgagatg accctgaaaa ccgccggcag tgatgttggc       240
     ggcctgcatc agcggccgga gtacaacgtt gcgctggatg caccgcagct ggatctccgt       300
     cgctttccag cgcaggtgtg gccggatggc tgcgatgtcg acgcactgca ggcggcgctg       360
     cagccgctgt tctcgaccga ttttcagcgg gagaggtggg tggtgacgta ccgtgagagc       420
     cagattgaag tggcgcttga ccggggcgat atttgcgccg cgggggagcg tgaggcgctg       480
     catgaaatcg agctggagct gctgcagggc gaacggggcg atctgctcgc ttttgccgaa       540
     cagttgctga cgctggatgg gatccggatg ggggccatga gtaaggccgc ccgcggctac       600
     cgtctggcgg cgggaaatgc ggcgctgcgg cggcgggcgt ttccgctgct gcggcccgcg       660
     gtacgcgcca gcgtcgaaca gggcatgtct gccgcgctga cacagatcct ggcgcactgg       720
     caataccatg aagaggcctg gctgcgggga gatgcggagt cccgggatgg gatccaggag       780
     gcgctggtag cgttgcggca gagtttgacc ctcttcggcg gcatcgtgcc gcgtaaggcc       840
     agtgcgacgc tacgcgccgg actgagcgcg ctggaggcac agatacagca gccggcgtgc       900
     gcggcgcaga cgttgtgcta tggccgggaa tccctgacta cccagtgggc actcactcgc       960
     tggttagccg agtctggctg gcgagcctat ctcgatgcgg cgggaagcgc caagctgtcc      1020
     ggctcgttca agcgctttgc cgacatcatg ctgggacgct gcggcgcgga gctgaaggcg      1080
     ctgtttgccc tggtacgtca tccccaggag tatcaggaca aactgccgcg tctgcagcat      1140
     caaattctgg cgatccgctt gctgggcggc gcgtatggcg aggcggcggt agacggctat      1200
     ctggcgccgt ggcagacgct ggcgcacgcc attgcccatc ccgccgcggc aacaccggag      1260
     gccgcctgcg cccaggcgct gcatcagccg gccttttggc gcaacggcgc gcattaa         1317
//

If you have problems or comments...

PBIL Back to PBIL home page