(data stored in ACNUC7421 zone)

EMBL: CP001600.PE500

CP001600.PE500       Location/Qualifiers
FT   CDS_pept        536612..538045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0538"
FT                   /product="RfaE bifunctional protein, putative"
FT                   /EC_number="2.7.1.-"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67771"
FT                   /db_xref="GOA:C5BHH2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHH2"
FT                   /protein_id="ACR67771.1"
FT                   /translation="MKVTLPDFRRAQVLVVGDVMLDRYWYGPTSRISPEAPVPVVKVET
FT                   IEERPGGAANVAMNIASLGASARLVGLTGVDDAARALSTRLDEVHVECDFVAIPAQPTI
FT                   TKLRVLSRNQQLIRLDFEEGFGGVDPGPILARIRQALPQVGAVILSDYAKGALASVQAM
FT                   ICLARDAGVPVLIDPKGTDFERYRGATLLTPNLSEFEAVVGRCHSEQEIVDRGLALMER
FT                   FDLTALLVTRSEQGMTLLQRGIAPLHMPTQAQEVYDVTGAGDTVIGMLAASIAAGASLD
FT                   EACFLANAAAGVVVGKLGTSTVSPIELENAIRGRADTGFGVMTQEELKTAVLQARQRGE
FT                   KVVMTNGVFDILHAGHVSYLANARRLGDRLIVAVNSDASTSRLKGPERPVNPLVQRMLV
FT                   LAALEAVDWVIPFEEDTPQRIIAEILPDLLVKGGDYKPEEIAGGKEVIAAGGEVRVLNF
FT                   EDGCSTSNIINIIRQGQND"
     atgaaagtaa ccctgcccga ttttcgccgc gcccaggtgc tggtggtggg cgatgttatg        60
     ctggatcgct actggtatgg accgaccagc aggatttcgc cggaggcacc ggtgccggtg       120
     gtgaaggtgg aaaccattga agagcgtccc ggcggtgcgg ccaacgtggc gatgaacatt       180
     gcctctttgg gcgccagcgc gcgtctggtc ggactgaccg gcgttgatga cgccgcccgt       240
     gcgctcagca cgcgcctgga tgaggtgcac gtcgagtgtg acttcgttgc gattccggcc       300
     cagccaacca tcaccaagct gcgcgtcctg tcgcgcaatc agcagctgat ccgcctggac       360
     tttgaagagg ggttcggcgg cgtcgatccc gggccgattc tggcgcgtat ccgccaggcg       420
     ctgccgcagg tgggggcagt aatcctctct gactatgcca agggggcact ggcgtcggtg       480
     caggcgatga tctgtctggc gcgcgatgcc ggcgtgccgg tgctgatcga tcccaaagga       540
     accgactttg aacgctatcg cggcgcgact ctgctgaccc caaacctgtc tgagtttgaa       600
     gccgtggtcg ggcgttgtca cagcgaacag gagatcgtgg atcgtggcct ggcgttgatg       660
     gagcgtttcg atctgacggc gctgctggtg acgcgctctg agcagggaat gacgctgctg       720
     cagcgcggta ttgcaccgct gcatatgccg actcaggcgc aggaggtcta tgacgtaacc       780
     ggcgccggcg atacggtgat cgggatgctg gcggcgtcga ttgctgccgg ggcttcgctg       840
     gatgaggcct gcttcctggc caatgccgcc gctggcgtcg tcgtgggtaa gctgggtacc       900
     tcgaccgtgt cacccatcga gctggagaat gctattcgtg gccgcgctga taccggtttt       960
     ggcgtgatga cccaagagga gctgaaaaca gcggttcttc aggcacgtca gcgcggcgag      1020
     aaggtagtga tgactaacgg ggtcttcgat attctgcacg ccggtcacgt ttcctacctg      1080
     gctaatgccc gcaggctggg cgatcgcctg attgtggcgg tgaacagcga cgcctcaacc      1140
     agccgcctga aggggccgga gcgcccggtt aacccactgg ttcagcgtat gctggtgctg      1200
     gcagccctgg aggcggtcga ttgggtgatc ccgtttgagg aggatactcc gcagcggatt      1260
     attgcggaga tcctgcctga tctgctggtt aagggcggtg attataagcc cgaggagatc      1320
     gccggtggta aagaggtgat cgccgctggc ggtgaagtgc gggtccttaa ctttgaggat      1380
     ggctgctcaa ccagcaatat catcaatatc atccgtcagg gtcagaacga ctga            1434
//

If you have problems or comments...

PBIL Back to PBIL home page