(data stored in ACNUC7421 zone)

EMBL: CP001600.PE501

CP001600.PE501       Location/Qualifiers
FT   CDS_pept        538077..538601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0539"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67772"
FT                   /db_xref="GOA:C5BHH3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHH3"
FT                   /protein_id="ACR67772.1"
FT                   /translation="MAALKQELGLVQGVGLLSTSLLGTGVFAVPALAAQVAGNDSLWTW
FT                   PLLIVLVFPIAIGFAALGRHFPSAGGAAHFVGKAFGPHMARVTGWLFLSVIPVGLPASL
FT                   QIAAGFWQALFGWQGVALLVVELITLLTVWLLGMRGAGSSANLQTLIALLVVVLIAAVW
FT                   WRGGILPTQIP"
     gtggctgcat taaaacagga gttagggtta gtgcagggag tggggctgtt atccacctcg        60
     cttttgggga ccggggtttt tgcggttccg gcactggctg cccaggtcgc aggcaatgat       120
     agcctgtgga cctggccgtt attgatcgtt ctggtttttc ccatcgctat cggcttcgcc       180
     gcactggggc gtcatttccc cagtgccggt ggtgcagcgc acttcgtcgg taaggccttt       240
     ggcccgcata tggcgcgggt taccggctgg ctttttctgt cggtgatccc ggtggggctg       300
     cctgcgtcgc tgcagatcgc cgccggattc tggcaggcgc tgtttggctg gcagggcgtg       360
     gccctgctgg tggttgagct gattacgctg ctgaccgtgt ggctgctggg tatgcggggg       420
     gcgggatcca gcgccaacct gcagaccctg atcgcgctgc tggtggtggt gctgattgct       480
     gccgtttggt ggcgcggcgg gatcttgccg acgcaaatcc cctag                       525
//

If you have problems or comments...

PBIL Back to PBIL home page