(data stored in ACNUC7421 zone)

EMBL: CP001600.PE502

CP001600.PE502       Location/Qualifiers
FT   CDS_pept        538653..539324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0540"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67773"
FT                   /db_xref="GOA:C5BHH4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHH4"
FT                   /protein_id="ACR67773.1"
FT                   /translation="MFWCFVGLEAFAHLASEFRHPQRDFPRALLLGLLLAGAVYWACSV
FT                   AVLHFHAFGDGRAAAASLPGIVVQLFGRHALWVACVIGYLACFASLNVYIQSFARLVWS
FT                   QAQRRPQSRLAQLSARQAPLNALTAVMLCCLLCSLLIYLSGLSLDALIVYANGVFIMIY
FT                   LLCMLAGCRLLRGPARLMARMGSVLCLLLLAMVGVRSLYALGMLLLLYLLLPRRAVPHG
FT                   G"
     atgttttggt gctttgtcgg cctagaggcc tttgcccatc tggcatcaga gtttcgtcat        60
     ccgcagcgtg attttccgcg ggcactgctg ctggggctac tgctggccgg ggcggtttac       120
     tgggcctgca gcgtggcggt gcttcacttt cacgcctttg gtgatgggcg tgcggcggca       180
     gcgtcattac cgggaattgt ggtgcagctg ttcggccgcc atgcgttatg ggtcgcctgc       240
     gtcatcggtt atttggcctg ctttgccagc ctgaacgttt atatccagag cttcgcccgg       300
     ctggtgtggt cgcaggcgca gcggcggccg cagagccgac tggcacagct ctctgcccgt       360
     caggcgccgc tcaatgcgct gacagcggtg atgctgtgct gtttactgtg ctcactgctg       420
     atttatctca gtggtctatc gctggatgcg ctgatcgtgt atgccaacgg cgtatttatc       480
     atgatctacc tgctgtgtat gttggccgga tgccgtctgc tgcgtggccc cgcccggctg       540
     atggcgcgga tgggcagcgt actgtgcctg ctgctgctgg cgatggtggg ggtgaggagc       600
     ctgtatgcgc tggggatgct gttgctattg tatctcctgc tgccgcgccg cgcggtgccg       660
     cacggcgggt ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page