(data stored in ACNUC7421 zone)

EMBL: CP001600.PE503

CP001600.PE503       Location/Qualifiers
FT   CDS_pept        complement(539343..539609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0541"
FT                   /product="Protein of unknown function (DUF526)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67774"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHH5"
FT                   /protein_id="ACR67774.1"
FT                   /translation="MIDPKKIEQIARQVHQSMPKGLREFGDDMEKRVRQILQQQLSRLD
FT                   LVNREDFDVQTQVLLRTREKLALLEQRVAALEARLNDAGDGQA"
     atgattgatc ccaagaaaat tgaacagatt gcccgtcagg tgcatcaatc catgccaaaa        60
     ggactgcgcg agttcggtga tgatatggag aagcgcgttc gccaaattct ccaacagcag       120
     ctcagccggc tggatttggt caaccgcgag gactttgacg ttcagactca ggtactgctg       180
     cgtacccgcg aaaagctggc gctgctggag cagcgcgtag ccgccctgga ggcgcgcctg       240
     aacgatgccg gggacgggca ggcataa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page