(data stored in ACNUC7421 zone)

EMBL: CP001600.PE505

CP001600.PE505       Location/Qualifiers
FT   CDS_pept        541084..541392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0543"
FT                   /product="Transposase IS200 like protein"
FT                   /note="Transposase IS200 like"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67776"
FT                   /db_xref="GOA:C5BHH7"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHH7"
FT                   /protein_id="ACR67776.1"
FT                   /translation="MFDQDAIEKLRIYFASVCADFDVELVEMDGERDHVHLLINYPPKL
FT                   AVSSLVNSLKGVSSRLLRRDRPDIAARYYYKGVLWTPSYFASSCGGAPISIIKQYIE"
     gtgtttgatc aggatgctat cgagaagcta cgaatctatt ttgccagtgt atgcgctgat        60
     tttgatgttg agctggttga gatggatgga gaaagagatc acgttcacct gctgatcaac       120
     tacccaccaa aattagcggt atccagtttg gtgaacagcc tcaagggggt gtccagtagg       180
     ttactgcgtc gtgatcgccc cgacattgcc gcacggtatt actacaaagg cgttctatgg       240
     actccgagtt actttgccag tagttgcggc ggagcgccaa tatccatcat caagcaatac       300
     attgagtaa                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page