(data stored in ACNUC7421 zone)

EMBL: CP001600.PE509

CP001600.PE509       Location/Qualifiers
FT   CDS_pept        complement(545010..546050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0551"
FT                   /product="methyltransferase, small subunit domain protein"
FT                   /note="methyltransferase, small subunit domain"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67780"
FT                   /db_xref="GOA:C5BHI1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR013675"
FT                   /db_xref="InterPro:IPR023543"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHI1"
FT                   /protein_id="ACR67780.1"
FT                   /translation="MSAFTPASEVVLRHREEFEPRRVLFAGDLQDTLPAQFNAVEVRAH
FT                   TTQYHHWQALHTAMGDRCLFSLTISAEFAAGIDTLIYFWPKSKPEALFQLTQLLAQLPA
FT                   GCDVFIVGENRAGVRSAEEMASGMLTLNKIDSARRCGLYHGLLAQPPHFDLNDWWMSYD
FT                   TGSLRIATLPGVFSRDGLDIGSHLLLSSLPHGLKGRVLDVGCGAGVLSAAITRMSPETT
FT                   LTLSDVNAAALTASRQTLAQNEIDGEILASNVFSDISGRFDLIISNPPFHDGVQTSLLA
FT                   AQTLIRGAVSHLQLGGELRIVANAFLPYPQVLDAVFGRHEVVAQTGKFKVYSAILDRAA
FT                   LEQSRR"
     atgtccgctt ttaccccggc cagcgaagtt gtacttcgcc atcgcgaaga gtttgagcca        60
     cgccgcgtcc tgttcgccgg cgatctgcag gatacgctgc ccgcgcaatt taacgccgtg       120
     gaagtccgcg ctcacaccac ccagtaccac cactggcagg cgctgcatac cgccatgggc       180
     gatcgctgcc tgttctctct gaccatctcg gcagaattcg ccgccggcat tgataccctg       240
     atctacttct ggcccaagag taagccggag gcgctgttcc agctgactca actactcgcg       300
     cagttgccgg ccggctgcga cgtgtttatc gtcggtgaga accgcgccgg cgtccgcagc       360
     gccgaagaga tggcgtccgg catgctgacg ctgaataaga tagacagcgc ccgccgctgc       420
     ggcctgtacc acggtcttct ggcccagccg ccccacttcg atctgaacga ctggtggatg       480
     tcctatgaca ccggcagtct gcgcatcgcc acgctgccgg gcgtattcag ccgcgacggg       540
     ctggacattg gcagccacct gctgctctcc tctctgcccc atggactgaa aggacgggta       600
     ttggacgtcg gctgcggcgc cggggtgtta tccgccgcca ttacccgcat gtcgccggag       660
     accacgctca ccctgagcga tgtcaacgcc gccgccctga ccgccagccg acaaacgctg       720
     gcgcagaatg agatcgacgg cgagatactc gccagcaatg tcttctcaga tatcagcggc       780
     cgcttcgatc tgatcatctc taacccgcca tttcatgacg gcgtacagac cagcctgctg       840
     gcagcacaga cgctgatccg cggcgcagtc agtcatctgc agctgggcgg tgagctgcgc       900
     atcgtcgcca acgccttcct gccctatcca caggtgctgg atgccgtatt cggtcgtcat       960
     gaggtcgtag cccagaccgg gaaattcaag gtgtactccg ccattctcga ccgggcagca      1020
     ctggaacaga gccgtcgata a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page