(data stored in ACNUC7421 zone)

EMBL: CP001600.PE510

CP001600.PE510       Location/Qualifiers
FT   CDS_pept        546246..546656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0552"
FT                   /product="DNA polymerase III, psi subunit, putative"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67781"
FT                   /db_xref="GOA:C5BHI2"
FT                   /db_xref="InterPro:IPR004615"
FT                   /db_xref="InterPro:IPR036654"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHI2"
FT                   /protein_id="ACR67781.1"
FT                   /translation="MTSRRDQLLQQLGITQWVLRRPALLRGEIAITLSAQTRLLIVSEV
FT                   PLSPDDLLLCDILRALSLAAEQAVILTPEQYEMLGDRQRYLCWWLGEPASSEACLRSPA
FT                   LSALYHNPGAKRALWQQICHEQHHFFPDPGGH"
     atgacttcgc gacgcgatca acttttacag cagctgggga taacccaatg ggtcctgcgt        60
     cgcccggcgc tactgcgtgg cgagatcgcc attacgctgt cggcgcagac acggctgctt       120
     attgtgtctg aggttcccct gtcgccggat gatctgttac tgtgcgacat tctacgcgcg       180
     ctgtcgctgg cggcggagca ggcggtgatc ctgacgccgg agcagtacga gatgctcggc       240
     gatcgccagc gttacctgtg ttggtggctg ggggagcccg cctcctctga ggcttgcctc       300
     cgctctccgg cgctcagtgc gctttaccat aaccccggtg ccaagcgcgc cctgtggcag       360
     caaatttgtc atgagcaaca ccatttcttc cctgatcccg gcggacactg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page