(data stored in ACNUC7421 zone)

EMBL: CP001600.PE516

CP001600.PE516       Location/Qualifiers
FT   CDS_pept        complement(552447..553310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0558"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67787"
FT                   /db_xref="GOA:C5BHI8"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023912"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR040074"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHI8"
FT                   /protein_id="ACR67787.1"
FT                   /translation="MNNRRALVSKLLPFSCVDGPGIRLVLFLQGCNLRCRGCHNPYTIG
FT                   RCDDCAQCVAACPHQALSLQAGKILWDALSCRQCDTCLQGCPRQANPMALSLSVDDVLM
FT                   QLRRQAAFIKGITVSGGEATLQLPFLLALFQAIRRDPGLQALDCLVDSNGELSEPGWTR
FT                   LIPWCDGVMVDLKAWGDERHRWLTGRGNRRILHSILWLAQRRRLAELRLLVIPQHSDYL
FT                   AHIDALAEFILLLDDVPVRLNAFHHHGVYGPASAWLTATKADIEQVAQALEARGVGAVI
FT                   RPALYL"
     atgaacaaca gacgcgcttt agtcagtaag ctactgccct tctcctgcgt ggatggaccg        60
     ggcatccgtc tggtgctgtt cctgcagggc tgcaacctgc gctgccgcgg ctgccataac       120
     ccctatacca ttggccgctg cgacgactgt gcacaatgtg tagcggcctg tccgcatcag       180
     gcgctgtcgc tgcaggcggg aaagattctc tgggatgcac tctcctgccg acagtgcgat       240
     acctgtctgc agggctgccc acgtcaggcg aaccccatgg cactctctct cagcgtcgac       300
     gatgtgctga tgcagctacg ccgtcaggct gcgtttatca aggggatcac cgtcagcggg       360
     ggagaggcga cgctgcagct ccctttcctg ctggcgctgt ttcaggcgat acgccgcgat       420
     ccggggttac aggcgctcga ctgtctggtc gacagcaatg gtgaattgtc agaaccaggc       480
     tggacacggc taataccgtg gtgcgacggc gtgatggtcg atctcaaggc ctggggcgac       540
     gagcgccacc gctggctgac cgggcgcggc aatcggcgca ttctgcacag tattctctgg       600
     ctggcacagc ggcgacgcct ggcggagctc cgcctgctgg tgatcccgca gcacagcgac       660
     tacctggccc acatcgatgc gctggccgaa tttatcctgt tgttggacga tgtgcccgtc       720
     cgcctgaatg ccttccatca tcacggcgtt tatggcccgg catcagcatg gctaaccgcc       780
     acaaaggccg atatcgaaca ggtggctcag gcgctggagg cccgcggcgt cggcgcagtg       840
     atccgcccgg cgctctacct ataa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page