(data stored in ACNUC7421 zone)

EMBL: CP001600.PE517

CP001600.PE517       Location/Qualifiers
FT   CDS_pept        complement(553282..553698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0559"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67788"
FT                   /db_xref="InterPro:IPR016905"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHI9"
FT                   /protein_id="ACR67788.1"
FT                   /translation="MPDSSDRGTTPGAHLPYGCEPDPVGHLMAVAPHHAYYPAGISDIL
FT                   TLDPTVKSNPQALMQLCLGAFSAGMREFTANVSGNDLVRVTGYMVRLSDLARYGQEGSR
FT                   LNTTRLAEEAARNTGMLERRARMISHEQQTRFSQ"
     atgcctgaca gcagcgatcg gggcacgacg cccggtgccc accttcccta tggctgcgag        60
     ccggatccgg tcggccatct gatggccgtc gcgccgcacc acgcctatta tcccgctggg       120
     atcagtgaca ttctgaccct cgatcccacg gtgaaaagca acccacaggc cctgatgcaa       180
     ctgtgcctcg gcgcgttctc cgccgggatg cgtgaattca cggccaacgt cagcggcaac       240
     gatctggtgc gggtaaccgg ctatatggtg cgcctgtccg atctggcgcg ctatggacag       300
     gagggctcgc ggctgaacac caccaggctg gcggaagagg cggcacgcaa tacgggtatg       360
     ctggagcgcc gggcgcgcat gataagccat gaacaacaga cgcgctttag tcagtaa          417
//

If you have problems or comments...

PBIL Back to PBIL home page