(data stored in ACNUC7421 zone)

EMBL: CP001600.PE518

CP001600.PE518       Location/Qualifiers
FT   CDS_pept        complement(553691..554758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0560"
FT                   /product="conserved hypothetical protein, authentic
FT                   premature stop"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67789"
FT                   /db_xref="InterPro:IPR016905"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHJ0"
FT                   /protein_id="ACR67789.1"
FT                   /translation="MAIACDPHLSALQKRHFLALEAENDLPYPTLPEAARRALDEGVIC
FT                   DMFEGHAPYKPRYVLPDYTRFLANGSEWLELGPAQDFDDALSMLTILYHHVPSVTSMPV
FT                   FLGYLDQLLLPYVGILTEEELYIRIKRFWRYLDRTFPDAFMHANLGPSDNILTRLFLRA
FT                   DVELAQVVPNLTFLYHPDITPTERLQQAIENICTCSKPHIANAPLHDNIFTAGGYGIVS
FT                   CYNVLPLGGGGSTLVRLNLKEVALRSQGEEDFFTRTLPDYCRRQTEILRARSDFLFTRS
FT                   HFFSQSFLVHGGLIDAQRFVPMFGIFALAEAVDILCQQSGSAARYGQDETANALGYRIS
FT                   VWLDAFVRATPLPHA"
     atggctatcg cctgcgatcc ccatctctcc gccctgcaaa aacgccactt tctcgcgctg        60
     gaagcagaga acgatctgcc ctatccaact ctaccggaag ccgctcgccg ggcgctggac       120
     gagggcgtca tctgcgatat gtttgaaggt catgcgccct ataagccccg ctatgtacta       180
     ccggactaca cccgcttctt ggccaacggc tctgagtggc tggaacttgg gccggcacag       240
     gattttgacg atgcactctc catgttgacc attctgtatc accatgtccc atccgtcaca       300
     tctatgccgg tgtttttggg gtatttagac caactattgc ttccgtatgt tggaatttta       360
     acagaagaag aattatatat ccgcataaaa cgcttttggc gttatctgga tcgcactttt       420
     cccgatgcct ttatgcacgc aaacctgggg ccgtcagata acatcctaac acgtctgttt       480
     ttacgcgcgg acgttgagct ggctcaggtc gtccccaacc tgaccttcct ctatcaccct       540
     gatatcacgc ctacagagcg cctgcagcag gccattgaaa acatctgcac ctgcagtaaa       600
     ccgcacatcg ccaacgcgcc gctgcatgat aatattttca cagcgggcgg atatggcatc       660
     gtaagctgct acaacgtact gccgctgggt ggcggcggca gcaccctggt ccgtctgaac       720
     ctgaaagagg tggccctgcg cagccagggg gaggaggact tttttacccg caccctgcct       780
     gactactgcc gacgccagac cgagattctc cgcgcccgca gcgactttct gtttacccgt       840
     tcccatttct tcagccagag cttcctggtg catggagggc tgatcgacgc ccaacgtttt       900
     gtgccgatgt tcggcatctt tgccctagca gaggcggtcg atattctgtg tcagcagagc       960
     ggcagcgccg cccgctacgg tcaggatgag acggccaacg ccttaggcta tcggatcagc      1020
     gtctggctgg atgcgtttgt ccgcgcgacc ccgctccccc atgcctga                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page