(data stored in ACNUC7421 zone)

EMBL: CP001600.PE519

CP001600.PE519       Location/Qualifiers
FT   CDS_pept        complement(554790..554975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67790"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHJ1"
FT                   /protein_id="ACR67790.1"
FT                   /translation="MTINETDANAQMHASHGITLTYPPLAAGNPAGTTPGSHAVTGHSP
FT                   TLILIITLIAMDTDHA"
     atgactatta acgaaaccga cgctaacgcg caaatgcacg caagccacgg cattacactg        60
     acctatcccc cgctggctgc cggtaacccc gcaggcacga caccgggatc tcatgccgtt       120
     acaggacaca gccctacgct catcctgatc atcactctca tcgccatgga caccgatcat       180
     gcctga                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page