(data stored in ACNUC7421 zone)

EMBL: CP001600.PE525

CP001600.PE525       Location/Qualifiers
FT   CDS_pept        560192..560683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0567"
FT                   /product="Nickel-dependent hydrogenases b-type cytochrome
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67796"
FT                   /db_xref="GOA:C5BHJ7"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHJ7"
FT                   /protein_id="ACR67796.1"
FT                   /translation="MRLTHWSVALGFLCNRLYLTVPGGTPHQLIGLTVAGLVLLRLLWG
FT                   VTWARGAARLSAFIPTPSALIHHLHELRTRTVPPVLHHNPLGALGIWATWLLLLLIALT
FT                   GWGQGTDLVFRWPVDVWHVWLVDALTLVVCVHIVAVFTLSFWLRRNLINAMLPGRHGGE
FT                   "
     gtgcgcctga cacactggag cgtggcgctg ggctttctgt gtaaccgcct gtatctgacg        60
     gtgcccggtg gtacgccgca ccagctcatt ggcctgacgg ttgccgggct ggtgctgctg       120
     cgcctgctgt ggggcgtgac gtgggcgcgt ggggcggcgc gtctttcggc gtttattccg       180
     acgccaagtg cgctgatcca ccatctgcat gagctgcgca cccgtacggt gccgccggtg       240
     ctgcaccaca atccgctggg ggccctcggt atctgggcga cttggctgct gctgttgctg       300
     attgcactga cgggctgggg gcaggggacc gacctggttt ttcgctggcc ggtggacgtc       360
     tggcatgtct ggttggtcga tgcgctgacg ctggtggtct gcgtgcatat agtggcagta       420
     tttacgctgt cgttttggct gcggcggaat ctgattaacg cgatgctgcc ggggcgccac       480
     ggcggggagt ag                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page