(data stored in ACNUC7421 zone)

EMBL: CP001600.PE527

CP001600.PE527       Location/Qualifiers
FT   CDS_pept        complement(561260..561532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0569"
FT                   /product="phosphocarrier, HPr family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67798"
FT                   /db_xref="GOA:C5BHJ9"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHJ9"
FT                   /protein_id="ACR67798.1"
FT                   /translation="MSVTQTVEIKNRLGMHARPAMKLFELVQTFDADVILRNENGIEAE
FT                   ANSVIALLMLDSAQGGQIEIQATGPDERQALDAVVSLFNAGFDEE"
     atgagcgtga cgcaaaccgt agagatcaaa aaccgtctgg gtatgcatgc ccgcccggcc        60
     atgaagctgt tcgaactggt gcaaaccttc gatgccgacg tcattctgcg caatgaaaac       120
     ggcatcgagg ccgaagccaa cagcgtgata gccctgctga tgctcgactc cgcgcagggg       180
     ggacagattg agattcaggc caccggccca gacgagcgcc aggcgctgga tgccgtcgtc       240
     tcactgttca acgccggctt cgacgaagag taa                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page