(data stored in ACNUC7421 zone)

EMBL: CP001600.PE528

CP001600.PE528       Location/Qualifiers
FT   CDS_pept        complement(561540..562391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0570"
FT                   /product="Uncharacterized P-loop ATPase protein family
FT                   (UPF0042)"
FT                   /note="Uncharacterised P-loop ATPase protein family
FT                   (UPF0042)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67799"
FT                   /db_xref="GOA:C5B725"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B725"
FT                   /protein_id="ACR67799.1"
FT                   /translation="MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVELLPELARTLA
FT                   TRDTSAAVSIDVRNMPESPEVLETAMDHLPESFTPQLLFLDADRNTLIRRYSDTRRLHP
FT                   LSSKNLSLENAIDQENELLEPLRSRADLIIDTSEMSVHELAEMLRARLLGKRERELTMV
FT                   FESFGFKHGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPVAAFLDRHTEVHNFIYQT
FT                   RSYLEQWLPALENNNRSYLTVAIGCTGGKHRSVYVAEQLADYFRSRGKNVQSRHRTLEK
FT                   RK"
     atggtgctga tgattgtcag cggccgttcc ggttcaggga aatctgtagc cctacgcgcc        60
     ttggaggata tgggatttta ctgcgtcgat aatctaccgg tcgagctgct gccagagcta       120
     gcgcgcacgt tggccacccg ggatacctcc gcggcggtca gcattgacgt acgtaacatg       180
     cccgagtcgc cggaggtgct ggagacggca atggaccatc tgccggagag ctttacgccg       240
     cagctgttgt tccttgatgc cgatcgcaat acgctgatcc gccgctacag cgatacccgt       300
     cgcctgcatc ctctgtcgag caaaaacctg tcgctggaga acgccatcga tcaggagaac       360
     gagctgctgg agccgctgcg ctcccgcgcc gatctcatca tcgacacgtc ggagatgtcg       420
     gtgcatgagc tggcggagat gctgcgcgcc cgcctgctgg gtaagcgcga gcgcgaactg       480
     accatggtat tcgaatcctt cggctttaaa cacggtattc ccatcgacgc tgactatgtt       540
     ttcgatgtcc gtttcctgcc caatccccac tgggatccca aactgcgtcc gatgaccgga       600
     ctggataagc cggtggcggc gttcctcgat cgccacactg aagtacacaa ctttatctac       660
     cagacccgca gctaccttga gcagtggcta ccggcgctgg agaacaataa ccgtagctac       720
     ctgacggtcg cgatcggttg caccggcggt aaacaccgct cggtctatgt cgccgagcag       780
     ctggcggact acttccgctc gcgcggcaag aacgtgcagt cccgtcaccg caccctggaa       840
     aaacgcaagt ag                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page