(data stored in ACNUC7421 zone)

EMBL: CP001600.PE529

CP001600.PE529       Location/Qualifiers
FT   CDS_pept        complement(562489..562953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0571"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67800"
FT                   /db_xref="GOA:C5B726"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:C5B726"
FT                   /protein_id="ACR67800.2"
FT                   /translation="MSNDLTMPLSVVLTPECTRNAVHCASKKRVLEIISELAAAQLNLP
FT                   TQVVFDAILTRERMGSTGIGNGIAIPHGKLEEDTLRAIAVFIHLDQPINFDAIDNQPVD
FT                   LLFALLVPADQCKTHLQTLSLMAQKLSDKGVCRRLRAAQSDEGLYQIITE"
     atgagtaatg acttaactat gcccttaagc gtcgtgctga ctccggaatg cacgcgcaac        60
     gccgtccatt gcgccagtaa gaagcgcgta ctggaaatca tcagcgaact ggccgccgcc       120
     cagctcaacc tgccgactca ggtcgtcttc gacgccattc tgacccggga acgcatgggc       180
     agtaccggga tcggcaacgg gatcgccatc ccccatggca agctggaaga agacaccctg       240
     cgcgccatcg ccgtctttat tcacctcgat cagcctatta acttcgatgc cattgacaat       300
     cagccagtcg acctgctgtt tgccctgttg gtaccggcag atcagtgtaa aacacacctg       360
     caaaccctat cgctgatggc ccagaagctc tcagataagg gcgtttgccg ccgcctgcgc       420
     gcggcgcaaa gcgatgaagg actgtaccag atcatcaccg aatga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page