(data stored in ACNUC7421 zone)

EMBL: CP001600.PE53

CP001600.PE53        Location/Qualifiers
FT   CDS_pept        49089..49775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0055"
FT                   /product="DNA repair protein RadC, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67315"
FT                   /db_xref="GOA:C5B9D5"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR022820"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9D5"
FT                   /protein_id="ACR67315.1"
FT                   /translation="MAQGKVEGGWPQGAPPREKLLALGAAALSDRELLALFLRTGLPGV
FT                   HVIQLAERLLLRFGSLQGVLRADVDTFCASQGLGIAKFAQLQAVIELSRRVLRHRIGEE
FT                   SAITSPDLTALYLQNLFVSLEREIFVVLFLDNQHRVIRSEQMFSGTINCVDVYPREIVR
FT                   EALKLNAVALILAHNHPSGNPEPSVADRLLTDRVAKACALVDIQVLDHMVIGHGQRVSF
FT                   AERGWI"
     atggcgcagg gtaaggtcga gggcggctgg ccacaggggg caccgccgag ggaaaagcta        60
     ctggcgttgg gtgcggcggc actcagcgat cgtgagttgc tggcgctgtt tctgcgcacg       120
     gggctgccgg gggtgcatgt gatacagttg gcggagcgcc tgttgctgcg ctttggatcg       180
     ctacaggggg tgctgcgggc agacgtcgat accttctgcg ccagccaggg gctgggcatc       240
     gccaagtttg cccagcttca ggcggttatt gagctgtcgc ggcgggtgct acggcaccgt       300
     atcggtgagg aaagcgcgat taccagcccc gatctgacgg cgctgtatct gcagaatctc       360
     ttcgtctcac tggagcgaga gatctttgtc gtgctgtttt tagacaatca acaccgtgtt       420
     attcgatctg agcagatgtt ttcaggtact ataaactgcg tggatgtata tccacgggaa       480
     atcgtcaggg aagcgctcaa gctgaatgct gtggcgttaa tcctggcgca caatcacccg       540
     tcgggcaatc ccgaacccag tgtggcggac cgtttgttaa cggatcgcgt ggctaaggcc       600
     tgcgcactgg tggatattca ggttctcgat catatggtca tcggccatgg tcagcgggtt       660
     tcctttgctg aacgtgggtg gatttaa                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page