(data stored in ACNUC7421 zone)

EMBL: CP001600.PE530

CP001600.PE530       Location/Qualifiers
FT   CDS_pept        complement(563073..563360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0572"
FT                   /product="ribosomal subunit interface protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67801"
FT                   /db_xref="GOA:C5B727"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:C5B727"
FT                   /protein_id="ACR67801.1"
FT                   /translation="MQLNITGHHLEITDAIRQFVSEKFAKLGQYFDRINQVNVTLSIEK
FT                   VDHIAEATVFINGGELHASAQQEDMYAAIDVLIDKLARQLNKHKDKLKQH"
     atgcagctca acattactgg acaccatctt gaaattactg acgccatccg tcagtttgtc        60
     agcgagaaat ttgccaagct tgggcagtat tttgaccgaa tcaatcaggt caacgtcact       120
     ctcagtattg aaaaggtcga tcatatcgcc gaagcaaccg tgtttatcaa cggaggagag       180
     ctgcacgcct ccgcccaaca ggaagacatg tacgccgcta tcgatgtcct gatagacaaa       240
     ctggcccgcc agttaaacaa gcataaagac aaactgaaac aacattaa                    288
//

If you have problems or comments...

PBIL Back to PBIL home page