(data stored in ACNUC7421 zone)

EMBL: CP001600.PE532

CP001600.PE532       Location/Qualifiers
FT   CDS_pept        complement(564982..565707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0574"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67803"
FT                   /db_xref="GOA:C5B729"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C5B729"
FT                   /protein_id="ACR67803.1"
FT                   /translation="MARLIAENLAKSYKGRRVVENVSLTVNSGEIVGLLGPNGAGKTTT
FT                   FYMVVGIVPRDAGRIIIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLE
FT                   IRDDLNAEQRADRADELLDEFHIAHLRDNLGQSLSGGERRRVEIARALAANPKFILLDE
FT                   PFAGVDPISVIDIKKIIEHLRDRGLGVLITDHNVRETLDVCERAYIVSQGNLIAYGSPD
FT                   EILADEQVKRVYLGEEFRL"
     atggcaagat taattgcgga aaacctggcc aagtcctata agggccgcag ggtcgtagag        60
     aacgtcagtc tgacggtaaa ctccggcgag atcgttggcc tgctcggccc gaacggcgcc       120
     gggaaaacca ccaccttcta catggtggtc ggtatcgtgc cgcgcgatgc cgggcgcatc       180
     atcatcgatg acgatgatat cagcctactg ccactgcacg cccgcgcccg tcgcggcatt       240
     ggctacctac cgcaggaggc ctccattttc cgccgcctga gcgtttatga taacctgatg       300
     gccgtgctgg agatccgcga cgatctcaac gcagagcagc gcgccgatcg ggccgatgag       360
     ctgttggacg agttccatat cgcccatctg cgcgataacc tggggcaatc cctctccggc       420
     ggcgaacggc gccgggtgga gatagcccgc gcgctggctg ccaatcccaa gtttattctg       480
     ctggacgagc cctttgccgg agttgatccc atctccgtta tcgatatcaa aaaaattatc       540
     gaacacctac gcgatcgtgg cctcggggtt ctgataaccg accacaacgt gcgtgaaaca       600
     ctggacgtgt gcgagcgggc ctacatcgtc agccagggta atctgatagc ctacggctct       660
     cccgacgaga tactggccga cgagcaggtc aaacgcgtct atctggggga ggagttccgg       720
     ctgtaa                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page