(data stored in ACNUC7421 zone)

EMBL: CP001600.PE533

CP001600.PE533       Location/Qualifiers
FT   CDS_pept        complement(565714..566271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0575"
FT                   /product="cell envelope biogenesis protein YhbN, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67804"
FT                   /db_xref="GOA:C5B730"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:C5B730"
FT                   /protein_id="ACR67804.1"
FT                   /translation="MKFKASTLKLRDLILAGALLSASASALAVTGDTDQPIHINSMQQS
FT                   LDMQGNVATFTGDVIVTQGTIKITADKVVITRPNGQQGSEIVEAYGNPVTFYQMQDNGK
FT                   PVEGHSQQLRYELAKDYVILTGKAFLKQLDSNIEGDRITYLVKQQQMEAFSDKGKRVTT
FT                   VLLPSQLQDKGSAKPAPQKKSN"
     atgaaattca aagcaagcac ccttaaactg cgtgatctga tccttgccgg cgccctgctg        60
     agcgccagtg cctctgcgct ggccgttacc ggtgataccg atcagccgat ccacattaac       120
     tcgatgcagc agtcgctgga tatgcagggc aacgtcgcca ccttcaccgg cgatgtgatc       180
     gtgacccagg ggaccattaa gatcaccgcc gataaagtgg tcatcacccg ccctaacggg       240
     cagcagggca gcgaaatcgt tgaggcctac ggtaacccgg tcaccttcta tcaaatgcag       300
     gataacggta agccggtgga gggccacagc caacaactgc gctatgaact ggccaaagac       360
     tatgtcattc tgaccgggaa ggcttttctg aaacagctcg atagcaacat tgagggcgat       420
     cggattacct atctggtgaa gcagcagcag atggaggcct tcagcgacaa aggcaagcgc       480
     gtaacgaccg tgctgctgcc gtcccagctg caggataaag gcagcgccaa accggcgcct       540
     cagaagaaga gtaactga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page