(data stored in ACNUC7421 zone)

EMBL: CP001600.PE534

CP001600.PE534       Location/Qualifiers
FT   CDS_pept        complement(566246..566797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0576"
FT                   /product="Protein of unknown function (DUF1239)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67805"
FT                   /db_xref="GOA:C5B731"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:C5B731"
FT                   /protein_id="ACR67805.1"
FT                   /translation="MIILLSLIALALIGWNLADNSPDGAPTTQDPNTPNYQSQHTLTVV
FT                   YDPSGKLSYKLVAQDVQHYSEQGVTWFTRPVLTTFDPQAAATWSVRADKAKLAKDNRLY
FT                   LYGNVEVNSLTPTSQLERITTDNAQVNLVTQDISSDDEVTLYGSNFTSHGLKMRGNMRD
FT                   KTARLIDKVNTYYEIQSKHP"
     gtgatcatcc tgctgagcct gatcgcgctg gcgctgattg gttggaatct ggcggataac        60
     tcgcccgacg gtgcaccgac gacacaggat cccaatacgc cgaactacca gagtcagcac       120
     accctgaccg tcgtctacga tcccagcggc aaactgagct ataagctggt ggctcaggat       180
     gtacagcact acagcgaaca gggtgtgacc tggtttaccc ggccggtgct gacgaccttc       240
     gatccccaag ctgcggcaac ctggtccgtt cgcgccgata aagccaagct ggcgaaagat       300
     aaccggttat atctctatgg caatgtagag gtcaatagct tgacgccaac ctcgcaactg       360
     gaaaggatta ccaccgataa tgcgcaggtg aatctggtga ctcaggatat aagctcggat       420
     gatgaggtaa cgctgtacgg cagcaatttc acctctcatg gactgaagat gcgcggaaat       480
     atgcgggata aaaccgcacg gttgatcgac aaggtaaaca cctattatga aattcaaagc       540
     aagcaccctt aa                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page