(data stored in ACNUC7421 zone)

EMBL: CP001600.PE539

CP001600.PE539       Location/Qualifiers
FT   CDS_pept        570602..571309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0581"
FT                   /product="Protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67810"
FT                   /db_xref="GOA:C5B736"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:C5B736"
FT                   /protein_id="ACR67810.1"
FT                   /translation="MLFSALVGRPEPGKQWPLLRRQLYSVGVQSLLIIIVSGLFIGMVL
FT                   GLQGYLVLTTYSAEASLGMMVALSLLRELGPVVTALLFAGRAGSALTAEIGLMKATEQL
FT                   SSLEMMAVDPLRRVVAPRFWAGVISMPLLTVIFVAVGIWGGSVVGVDWKGIDAGFFWSA
FT                   MQGAVDYRTDLLNCLIKSLIFAITVMWIALFNGYDAVPTSAGISRATTRTVVHASLAVL
FT                   GLDFVLTALMFGN"
     atgctcttca gcgcgctggt tggccgacca gagccgggta agcagtggcc actgctgcgc        60
     cgccagctgt acagtgtcgg ggttcagtcc ctgctgatca tcatcgtttc aggactgttt       120
     atcggcatgg tgctggggct gcaggggtat ctggtgctga cgacctacag cgccgaagcc       180
     agcctgggca tgatggtggc gctgtcgttg ctgcgtgaac tggggccggt ggtgaccgcc       240
     ctgctgttcg ccggacgtgc cggttcggcg ctgaccgcgg aaattggcct gatgaaggcg       300
     acggagcagc tctctagcct ggagatgatg gcggtcgatc cgctgcggcg tgtggtagcg       360
     ccgcgctttt gggctggggt gatcagcatg ccgctgctga cggtgatctt tgtcgccgtg       420
     gggatctggg gcggctcagt ggtcggtgtg gactggaaag gtatcgatgc aggtttcttc       480
     tggtcggcga tgcagggtgc agtggactat cgcaccgatc tgctgaactg tctgatcaag       540
     agcctgatat ttgccattac ggtcatgtgg atcgcgctgt ttaacggcta tgatgcggtc       600
     cctacctcgg cagggatcag tcgtgcgacg acacgcaccg tcgtgcatgc gtcgctggcg       660
     gttttaggtt tggattttgt gctgacggca ctgatgtttg ggaattga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page