(data stored in ACNUC7421 zone)

EMBL: CP001600.PE54

CP001600.PE54        Location/Qualifiers
FT   CDS_pept        50014..50250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0056"
FT                   /product="50S ribosomal protein L28, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67316"
FT                   /db_xref="GOA:C5B9D6"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B9D6"
FT                   /protein_id="ACR67316.1"
FT                   /translation="MSRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVEGEKR
FT                   FVTLRVSAKGMRVIDKKGIEAVLADLRARGEKY"
     atgtcccgag tctgccaagt tactggcaag cgtccggtga ccggtaacaa ccgttcccat        60
     gcgctgaatg cgaccaaacg ccgttttctg cctaacctgc actcacaccg tttttgggtt       120
     gaaggtgaga agcgctttgt aactctgcgt gtatctgcta aaggtatgcg tgtcattgat       180
     aagaagggta tcgaagcggt tctggccgat ctgcgtgccc gtggtgagaa gtattaa          237
//

If you have problems or comments...

PBIL Back to PBIL home page