(data stored in ACNUC7421 zone)

EMBL: CP001600.PE540

CP001600.PE540       Location/Qualifiers
FT   CDS_pept        571314..571847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0582"
FT                   /product="MCE related protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67811"
FT                   /db_xref="GOA:C5B737"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:C5B737"
FT                   /protein_id="ACR67811.1"
FT                   /translation="MQTKKAEVWVGLFMLIALCAAIFLCLQVANVKSLGSAPTYRLYAT
FT                   FDNVGGLKARSPVKIGGVVIGRVAEISLDPQTYLPRVAMDIDRRYNHIPDTSSLAIRTS
FT                   GLLGEQYLALNVGFEDPEMGTAILKDGGTIQDTKSAIVLEDLIGQFLYKSGGESTNAPA
FT                   STAPAGNTPAPVAH"
     atgcaaacga aaaaagctga agtatgggtc ggtctgttta tgctgatcgc cctgtgtgcc        60
     gccattttcc tctgtctaca ggtggccaac gtgaaatcgc tggggagcgc gcctacgtat       120
     cgcctgtacg ctacgtttga taacgtcggt ggcctgaagg cgcgctcccc ggtgaaaatc       180
     ggcggcgttg tgattggtcg ggtggcggag atttcattgg atccacagac ctatctgccg       240
     cgggtggcga tggacattga ccggcgttac aaccatattc ccgataccag ctccctggcg       300
     atccggacct caggcttgct gggagagcag tatctggccc tcaacgtcgg gtttgaagat       360
     ccggagatgg gtacagccat tctaaaagac ggtggcacca ttcaggatac caagtcagcc       420
     atcgtgctgg aggatctgat cggacaattc ctgtataaga gcggcggtga gagcactaat       480
     gcccctgcca gtacagcccc tgctggcaat acgccagcgc ctgtcgcaca ttaa             534
//

If you have problems or comments...

PBIL Back to PBIL home page