(data stored in ACNUC7421 zone)

EMBL: CP001600.PE541

CP001600.PE541       Location/Qualifiers
FT   CDS_pept        571868..572518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0583"
FT                   /product="toluene tolerance protein Ttg2D"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67812"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:C5B738"
FT                   /protein_id="ACR67812.1"
FT                   /translation="MLKRIVMVALLCVAPWFSAQASAAPMLDQSNPYTLMNQAAAATFS
FT                   RLKSEQPRIRQDPDYLRTIVREELMPYVQVKYAGALVLGQYYRGVTPTQRAAYFKAFQS
FT                   YLEQVYGQALALYHGQRYEVAAERPLGDATIVTIRVTIFDNQGRPPVRLDFQWRKNTQT
FT                   GHWQAFDMIAEGVSMITTKQNEWAAILREKGVDGLTQQLIAVAKQPITLDNKQ"
     atgttgaaac gtatagtgat ggttgcgctg ttgtgcgtgg cgccctggtt ttccgcgcag        60
     gccagcgctg caccgatgct ggaccaaagt aacccttata ccctgatgaa tcaggccgcc       120
     gccgcgacct ttagccgcct gaagagcgag cagccgcgta tcaggcagga ccccgactac       180
     ctgcgtacga tcgtgcgtga agagctgatg ccctatgtgc aggtgaagta tgccggtgcg       240
     ctggtgctgg gtcagtatta ccgcggtgtg acgccgacgc agcgcgccgc ctactttaag       300
     gcgttccaga gctatctgga gcaggtgtat ggtcaggcgt tggcgctgta tcatggtcag       360
     cgttatgagg tggccgcaga gcgtccgctg ggcgatgcta ccatcgtgac tatccgggtt       420
     acgatcttcg ataatcaggg gcgtccgccg gtgcgtctgg acttccagtg gcgaaaaaac       480
     acccagaccg gtcattggca ggcatttgac atgattgccg agggggtcag catgatcacc       540
     accaaacaga acgagtgggc cgccattctg cgcgagaaag gggtcgatgg cctgacgcag       600
     caattgatcg ctgtggcaaa acagcccatt acgctggaca ataagcagtg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page