(data stored in ACNUC7421 zone)

EMBL: CP001600.PE542

CP001600.PE542       Location/Qualifiers
FT   CDS_pept        572515..572829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0584"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67813"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C5B739"
FT                   /protein_id="ACR67813.1"
FT                   /translation="MTARGELRWRRDGAILYLQGVLECDSLGEIWQQRQALLTGIACLD
FT                   ISELSRVDSAGLALLLHVQNLRPEMPIPLRGISDRLRTLITLYNLQEIVPCAAPSANLA
FT                   "
     gtgaccgcgc gaggtgaact gcgctggcgg cgcgacggcg cgatcctgta tctgcagggg        60
     gtgctggagt gcgactcgct gggcgagatc tggcagcaac gccaggcgct gttgacgggg       120
     atcgcgtgtt tggatatcag cgaactgtcg cgggtggatt cagcggggtt agctctgctg       180
     ctgcatgtgc aaaacctgcg cccggagatg ccgataccgc tgcggggcat cagtgatcgc       240
     ctgcgtaccc tgatcaccct gtataatctg caggagattg taccgtgcgc tgcgccttcg       300
     gctaaccttg cgtaa                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page