(data stored in ACNUC7421 zone)

EMBL: CP001600.PE547

CP001600.PE547       Location/Qualifiers
FT   CDS_pept        576389..576559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67818"
FT                   /db_xref="UniProtKB/TrEMBL:C5B744"
FT                   /protein_id="ACR67818.1"
FT                   /translation="MRHIAGDRKDDTDAAADRGQDRGIDPDLFDLEVDQRPAGVTAVDG
FT                   GVGLNKVFQLS"
     gtgcgccata ttgctgggga tcgcaaagac gataccgatg ctgccgccga caggggccag        60
     gatcgcggta ttgatcctga tttgttcgac cttgaggttg accagcgccc tgccggagtt       120
     accgctgttg atggcggcgt cggtctgaat aaagttttcc agctctcctg a                171
//

If you have problems or comments...

PBIL Back to PBIL home page