(data stored in ACNUC7421 zone)

EMBL: CP001600.PE548

CP001600.PE548       Location/Qualifiers
FT   CDS_pept        complement(577063..577455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0590"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67819"
FT                   /db_xref="GOA:C5B745"
FT                   /db_xref="InterPro:IPR009386"
FT                   /db_xref="UniProtKB/TrEMBL:C5B745"
FT                   /protein_id="ACR67819.1"
FT                   /translation="MTWEYALIGLVVGIIIGALAMRFGNRKLRQQKTLQDELEKSKTDL
FT                   DQYRQELVNHFARSAELLDNMAKDYRQLYQHMATSSNNLLPDMPAHDNPFRYRLTEADN
FT                   DQAPVEIPPRDYSEGASGLLRADRHD"
     atgacttggg agtatgcgct tattggtttg gttgtcggta tcatcatcgg ggcgctggcg        60
     atgcgctttg gtaaccggaa actgcgccag cagaaaacgc tgcaggatga gctggagaaa       120
     agcaaaaccg atctggatca gtaccgccag gagctggtca accattttgc ccgcagtgca       180
     gagttgctcg acaacatggc gaaagattac cgccagctgt atcagcacat ggctaccagc       240
     tcgaataatc tgctgcctga tatgcctgca catgataatc cgttccgcta ccgtctgacg       300
     gaagcggata acgatcaggc gccggtcgag atcccaccgc gcgactattc agagggcgcc       360
     tccggcctgc tgcgcgccga tcgccacgat taa                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page